BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0591 (585 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55320.1 68418.m06894 membrane bound O-acyl transferase (MBOA... 27 7.0 At4g19380.1 68417.m02853 alcohol oxidase-related similar to long... 27 9.2 >At5g55320.1 68418.m06894 membrane bound O-acyl transferase (MBOAT) family protein / wax synthase-related similar to wax synthase [Simmondsia chinensis] GI:5020219 [EC 2.3.1.75] Length = 339 Score = 27.5 bits (58), Expect = 7.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 101 IKIAITVLLSIFPLCVLLKI 160 IK + LLSIFP+CVLL + Sbjct: 29 IKSGVLRLLSIFPVCVLLVV 48 >At4g19380.1 68417.m02853 alcohol oxidase-related similar to long chain fatty alcohol oxidase from Candida cloacae [GI:6983581], Candida tropicalis [GI:6983594] Length = 726 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -1 Query: 159 ILSKTHKGKIERRTVIAILMSHYFI*NES*ISLLHCNAL*TPHL 28 ++ +GK ++ T +A ES ++++ C AL TPHL Sbjct: 423 VMYDCEQGKKKKATGVAFAFGEEIYVVESRVTIVACGALRTPHL 466 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,812,335 Number of Sequences: 28952 Number of extensions: 138297 Number of successful extensions: 207 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 207 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -