BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0590 (705 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n... 80 6e-14 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 44 0.004 UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein;... 40 0.060 UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 38 0.24 UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ... 34 3.0 UniRef50_Q7N0G3 Cluster: Similarities with ribonuclease; n=1; Ph... 33 5.2 UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lu... 33 5.2 UniRef50_A1VP16 Cluster: Peptidase C14, caspase catalytic subuni... 33 9.0 >UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1; Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry - Gallus gallus Length = 103 Score = 79.8 bits (188), Expect = 6e-14 Identities = 43/74 (58%), Positives = 47/74 (63%) Frame = +1 Query: 415 GAPTARRTNATTSFLTATILVYXXXXXXXXXXXXRLALQLFLVKIFKVYSFRLRGLVRVP 594 G P AR + TTSFLTA L+Y RLALQ LVK FKV SF+L+GL RV Sbjct: 30 GGPPARSQDPTTSFLTAATLIYAIGAGITAAAGTRLALQWILVKGFKVDSFQLQGLERVL 89 Query: 595 YRYFSSLPPRAGSG 636 Y YFSSLPPR GSG Sbjct: 90 YCYFSSLPPRVGSG 103 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 44.0 bits (99), Expect = 0.004 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +1 Query: 73 GKCFR*CSSCDDPRISPLTSQYECPQ 150 GKCFR C S ++ RISPLTS+Y+CPQ Sbjct: 259 GKCFRSCLSPENLRISPLTSEYKCPQ 284 >UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 493 Score = 39.9 bits (89), Expect = 0.060 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +3 Query: 579 PRKSPVSLFFVTTSPCREW 635 PRKSPV LFFVTTSP REW Sbjct: 24 PRKSPVLLFFVTTSPGREW 42 >UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Nematostella vectensis Length = 79 Score = 37.9 bits (84), Expect = 0.24 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 64 FHQSRTKVRGSKAIRYRPSSN 2 F RTKVRGSK IRYRPSSN Sbjct: 6 FRCQRTKVRGSKTIRYRPSSN 26 >UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 76 Score = 34.3 bits (75), Expect = 3.0 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 489 SWNYRGCWHQTCP 527 SWNYR CWHQT P Sbjct: 7 SWNYRSCWHQTGP 19 >UniRef50_Q7N0G3 Cluster: Similarities with ribonuclease; n=1; Photorhabdus luminescens subsp. laumondii|Rep: Similarities with ribonuclease - Photorhabdus luminescens subsp. laumondii Length = 272 Score = 33.5 bits (73), Expect = 5.2 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = +3 Query: 369 SPTICSANVSVSPRMRCTDSAAH-KCNYELFNRNNFSIRYWSWNYRGCWHQTC 524 SP C R++ ++ A + YE F FS +SW G W QTC Sbjct: 92 SPAFCKGKAKNIERLKKSNKLAEAQREYEKFELQCFSENKFSWVIHGLWAQTC 144 >UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 72 Score = 33.5 bits (73), Expect = 5.2 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 64 FHQSRTKVRGSKAIRYRPSSN 2 FH RTKV GSK IRY PS N Sbjct: 6 FHCQRTKVGGSKMIRYHPSLN 26 >UniRef50_A1VP16 Cluster: Peptidase C14, caspase catalytic subunit p20; n=1; Polaromonas naphthalenivorans CJ2|Rep: Peptidase C14, caspase catalytic subunit p20 - Polaromonas naphthalenivorans (strain CJ2) Length = 562 Score = 32.7 bits (71), Expect = 9.0 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 393 VSVSPRMRCTDSAAHKCNYELFNRNNFSIRYWS 491 V+ PR+R D AA + NY L NR+N+ + W+ Sbjct: 163 VNAPPRVRAADPAAVQANY-LANRSNYEVSQWT 194 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 688,350,936 Number of Sequences: 1657284 Number of extensions: 13714183 Number of successful extensions: 31472 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 30532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31467 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56198352344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -