BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0588 (677 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_27194| Best HMM Match : C2 (HMM E-Value=1e-22) 32 0.49 SB_37945| Best HMM Match : C2 (HMM E-Value=2.7e-18) 31 0.65 SB_11671| Best HMM Match : C2 (HMM E-Value=4e-39) 31 0.65 SB_35182| Best HMM Match : CUB (HMM E-Value=0) 31 0.65 SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_23564| Best HMM Match : zf-CCHC (HMM E-Value=0.015) 31 1.1 SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) 30 1.5 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_863| Best HMM Match : C2 (HMM E-Value=5.4e-36) 30 2.0 SB_26831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_48346| Best HMM Match : PDZ (HMM E-Value=1.5e-33) 29 2.6 SB_47661| Best HMM Match : zf-CCHC (HMM E-Value=0.015) 29 3.5 SB_51621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_51789| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_26512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_23786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_20121| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_55980| Best HMM Match : rve (HMM E-Value=3.8e-23) 28 8.0 SB_56377| Best HMM Match : zf-CCHC (HMM E-Value=0.015) 28 8.0 SB_37007| Best HMM Match : Oleosin (HMM E-Value=0.43) 28 8.0 >SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 999 Score = 32.7 bits (71), Expect = 0.28 Identities = 25/106 (23%), Positives = 50/106 (47%), Gaps = 5/106 (4%) Frame = +3 Query: 195 WNEDFKFQLKQKEA-----KKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKT 359 WN+ + LK+K+ KK ++ +L+ + +E + +K Sbjct: 803 WNQQKEETLKEKQERLKAKKKEEEEKELEKRSKTKDAKKYFESWKSKKDEELKEAHRAKM 862 Query: 360 IDTKNAKVGDQEEPKAKTGFLEKTFSSFKATKAEAIAQKSILEKRR 497 + K K ++EE + KT +K+F ++KA K E + +K + EK++ Sbjct: 863 QELKKQKQKEEEEKQDKTLSSKKSFENWKAKKDEYL-KKELKEKKK 907 >SB_27194| Best HMM Match : C2 (HMM E-Value=1e-22) Length = 139 Score = 31.9 bits (69), Expect = 0.49 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 4/74 (5%) Frame = +3 Query: 12 EIGFKLALHPITKNLYVTVIGARHLPSLFGLSRAHGYLVKVKVFPGES---KYETTLQEN 182 E+ + P++ L VTV+ AR+LP + L+ Y VKV++F S K +T +++ Sbjct: 4 ELHISVCHQPLSSRLSVTVLQARNLPKISHLNIGDPY-VKVELFSSRSRVGKKKTRVKKK 62 Query: 183 SW-PVWNEDFKFQL 221 + P + + F F L Sbjct: 63 TVNPKFAQTFTFDL 76 >SB_37945| Best HMM Match : C2 (HMM E-Value=2.7e-18) Length = 194 Score = 31.5 bits (68), Expect = 0.65 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = +3 Query: 21 FKLALHPITKNLYVTVIGARHLPSLFGLSRAHGYLVKVKVFPGESKYETT--LQENSWPV 194 F + +NL VT++ AR+LPS R VK+ + P + + ++ P Sbjct: 66 FNIQYSTTGQNLVVTLVKARNLPSRSKTVRTCDPFVKIALLPKDKHVSQSRCKRKTKRPT 125 Query: 195 WNEDFKFQLKQKEAKKSS 248 +NE F + + E S+ Sbjct: 126 FNETFYIPIAEDELDSST 143 >SB_11671| Best HMM Match : C2 (HMM E-Value=4e-39) Length = 407 Score = 31.5 bits (68), Expect = 0.65 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = +3 Query: 21 FKLALHPITKNLYVTVIGARHLPSLFGLSRAHGYLVKVKVFPGESKYETT--LQENSWPV 194 F + +NL VT++ AR+LPS R VK+ + P + + ++ P Sbjct: 143 FNIQYSTTGQNLVVTLVKARNLPSRSKTVRTCDPFVKIALLPKDKHVSQSRCKRKTKRPT 202 Query: 195 WNEDFKFQLKQKEAKKSS 248 +NE F + + E S+ Sbjct: 203 FNETFYIPIAEDELDSST 220 >SB_35182| Best HMM Match : CUB (HMM E-Value=0) Length = 963 Score = 31.5 bits (68), Expect = 0.65 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = +3 Query: 21 FKLALHPITKNLYVTVIGARHLPSLFGLSRAHGYLVKVKVFPGESKYETT--LQENSWPV 194 F + +NL VT++ AR+LPS R VK+ + P + + ++ P Sbjct: 699 FNIQYSTTGQNLVVTLVKARNLPSRSKTVRTCDPFVKIALLPKDKHVSQSRCKRKTKRPT 758 Query: 195 WNEDFKFQLKQKEAKKSS 248 +NE F + + E S+ Sbjct: 759 FNETFYIPIAEDELDSST 776 >SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2179 Score = 31.1 bits (67), Expect = 0.86 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +3 Query: 54 LYVTVIGARHLPSLFGLSRAHGYLVKVKVFPGESKYETTLQENSWPVWNEDFKFQ 218 L V V A +LP++ + Y VK+ F GE K + +N PVW+ED +F+ Sbjct: 2 LRVVVKSAVNLPNVDFRGESDPY-VKLS-FRGEEKKTKVIDDNLNPVWDEDNEFE 54 >SB_23564| Best HMM Match : zf-CCHC (HMM E-Value=0.015) Length = 667 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 7/71 (9%) Frame = +3 Query: 183 SWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEAD------KR 344 +W W EDF+ +++ E K S DK+ + G + I EP D KR Sbjct: 36 AWKEWLEDFEEEVEYFEIKTSEDKVRAMKIYGGPEIKKLARNIPEPTPSADDNDFTRMKR 95 Query: 345 K-NSKTIDTKN 374 K NS + KN Sbjct: 96 KLNSHFLPKKN 106 >SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) Length = 690 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/60 (36%), Positives = 30/60 (50%) Frame = +3 Query: 327 QEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFSSFKATKAEAIAQKSILEKRRTVG 506 +E +K K+ K TK + +EE K T EK + +A AE A K LEK +T G Sbjct: 509 EELEKEKSEKL--TKEQEEALEEERKKLTEANEKFAADLEAKDAELKALKEELEKLQTSG 566 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 30.3 bits (65), Expect = 1.5 Identities = 34/126 (26%), Positives = 63/126 (50%), Gaps = 12/126 (9%) Frame = +3 Query: 147 GESKYETTLQENSWPVWN--EDFK-FQLK----QK---EAKKSSDKI--DLQNLVSGHFL 290 G++K E LQ+N +W+ +D K +LK QK E K +DK+ DL NL + Sbjct: 1410 GKAKAEAELQKNKSKIWDLEDDVKMLELKVDQLQKMLAETNKLNDKLKKDLNNLKRTSWD 1469 Query: 291 SLTIYAILEPPKQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFSSFKATKAEAIA 470 Y+++ K+E+D KN + K +++E +++ L K + +A + + Sbjct: 1470 QRNNYSVV---KKESDIHKNKVEMAEK-----ERDELESELNRLRKELADVRAQREKLNV 1521 Query: 471 QKSILE 488 +K+ L+ Sbjct: 1522 EKNDLK 1527 >SB_863| Best HMM Match : C2 (HMM E-Value=5.4e-36) Length = 454 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 6/73 (8%) Frame = +3 Query: 126 VKVKVFP---GESKYETTL-QENSWPVWNEDFKFQL--KQKEAKKSSDKIDLQNLVSGHF 287 VKVK+ P SK +T + +E+ PV+NE F+F++ K K+ + S + D F Sbjct: 136 VKVKLLPDPDNTSKKKTKIFKESLSPVFNETFEFKIQNKDKDRRLSIEVWDWDRTTRNDF 195 Query: 288 LSLTIYAILEPPK 326 + + + E K Sbjct: 196 MGSLSFGVSELQK 208 >SB_26831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 932 Score = 29.5 bits (63), Expect = 2.6 Identities = 29/96 (30%), Positives = 45/96 (46%) Frame = +3 Query: 201 EDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTIDTKNAK 380 E + +++ E + SS LQ + G L+ + +E K K++ IDT NAK Sbjct: 825 ESYVSTIERLENESSSKCSSLQETIWGLEKELSQFKEKTNQIEELLKEKDT-VIDTANAK 883 Query: 381 VGDQEEPKAKTGFLEKTFSSFKATKAEAIAQKSILE 488 V + EE G L+K S ++ AE A +S E Sbjct: 884 VSNLEE---TCGKLQKGLLSKESELAEVSAIRSASE 916 >SB_48346| Best HMM Match : PDZ (HMM E-Value=1.5e-33) Length = 708 Score = 29.5 bits (63), Expect = 2.6 Identities = 35/133 (26%), Positives = 62/133 (46%), Gaps = 1/133 (0%) Frame = +3 Query: 72 GARHLPSLFGLSRAHGYLVKVKVFPGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSD 251 G P + + +GY VK+ G + ET +QE E+ +K ++ K S D Sbjct: 202 GPSKTPGISEENMRNGYYTGVKIDLGRAGNETIIQE------KEEL---VKPQKRKNSFD 252 Query: 252 KIDLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKT 431 ++ +N++ +S ++ +LE K EA + KT + K G++ K KT Sbjct: 253 HVN-ENVMEKTKIS-SLNGVLESEKIEATSTR--KTESEPSDKAGNKSNGTKKERANSKT 308 Query: 432 FS-SFKATKAEAI 467 S S + TKA+++ Sbjct: 309 KSISPRLTKAQSL 321 >SB_47661| Best HMM Match : zf-CCHC (HMM E-Value=0.015) Length = 830 Score = 29.1 bits (62), Expect = 3.5 Identities = 22/95 (23%), Positives = 39/95 (41%) Frame = +3 Query: 183 SWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTI 362 +W W EDF+ +++ E K + DK+ + G + + L P AD ++ Sbjct: 82 AWKEWLEDFEEEVEYFEIKTTEDKVRAMKIYGGPEIK-KLARNLPKPTPSADDNDFTR-- 138 Query: 363 DTKNAKVGDQEEPKAKTGFLEKTFSSFKATKAEAI 467 K+ + PK + TF+ K E+I Sbjct: 139 --MKRKLNNHFLPKKNKHHVRYTFNKQKMETNESI 171 >SB_51621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 510 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = -1 Query: 509 CPYGPSFFQNRFLCYRFSFCRFETTECFLQKTCFSFGFLLISY 381 C Y + L YR SFC T CF + + L Y Sbjct: 389 CSYCTELYSTLLLLYRVSFCTVCTVPCFFRHCLYCTDILSALY 431 >SB_51789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/45 (33%), Positives = 28/45 (62%) Frame = +3 Query: 363 DTKNAKVGDQEEPKAKTGFLEKTFSSFKATKAEAIAQKSILEKRR 497 + K K ++EE + KT +K+F ++KA K E + +K + EK++ Sbjct: 3 ELKKQKQKEEEEKQDKTLSSKKSFENWKAKKDEYL-KKELKEKKK 46 >SB_26512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 28.3 bits (60), Expect = 6.0 Identities = 22/82 (26%), Positives = 35/82 (42%) Frame = +3 Query: 315 EPPKQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFSSFKATKAEAIAQKSILEKR 494 E KQ +DK+ SK + K +K E+ K +G K S+ K + + IL K+ Sbjct: 251 EKSKQVSDKK--SKQVPGKKSKQVPDEKSKQASGKKSKQESNTAGPKKKNECYRKILNKK 308 Query: 495 RTVGAATWNFDSKLFQNDLKNG 560 R + + K +NG Sbjct: 309 RRLQRRLRKLNEKYLICKTENG 330 >SB_23786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = +3 Query: 183 SWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEAD 338 +W W EDF+ +++ E K + DK+ + G + + EP D Sbjct: 205 AWKEWLEDFEEEVEYFEIKTTEDKVRAMKIYGGPEIKKLARNLPEPTPSADD 256 >SB_20121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2306 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = +3 Query: 183 SWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEAD 338 +W W EDF+ +++ E K + DK+ + G + + EP D Sbjct: 114 AWKEWLEDFEEEVEYFEIKTTEDKVRAMKIYGGPEIKKLARNLPEPTPSADD 165 >SB_55980| Best HMM Match : rve (HMM E-Value=3.8e-23) Length = 1268 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 324 KQEADKRKNSKTIDTKNAKVGDQEEPKAK 410 K+E +K+ N D K AK+ Q++PKAK Sbjct: 121 KEENNKQVNDMKEDFKVAKIQTQKKPKAK 149 >SB_56377| Best HMM Match : zf-CCHC (HMM E-Value=0.015) Length = 393 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 183 SWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSG 281 +W W EDF+ +++ E K + DK+ + G Sbjct: 82 AWKEWLEDFEEEVEYFEIKTTEDKVRAMKIYGG 114 >SB_37007| Best HMM Match : Oleosin (HMM E-Value=0.43) Length = 298 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 145 GNTFTLTRYPWARLNPNKEGRCR 77 G T LTR PWA LNP R R Sbjct: 37 GRTSPLTRRPWAPLNPPDSCRFR 59 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,070,129 Number of Sequences: 59808 Number of extensions: 419539 Number of successful extensions: 1129 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1127 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -