BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0588 (677 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 27 0.22 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 25 0.50 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 25 0.66 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 23 2.7 M12598-1|AAA27733.1| 77|Apis mellifera protein ( Bee preprosec... 22 4.7 AY082691-1|AAL92482.1| 77|Apis mellifera preprosecapin protein. 22 4.7 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 6.2 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 6.2 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 8.2 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 8.2 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 8.2 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 26.6 bits (56), Expect = 0.22 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -1 Query: 593 YGPPYVWS-SNQTVLQIILK*FRVKIPSGCP 504 YG W+ SNQ V++ I K +R+ P CP Sbjct: 834 YGERPYWNWSNQDVIKSIEKGYRLPAPMDCP 864 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 25.4 bits (53), Expect = 0.50 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 21 FKLALHPITKNLYVTVIGARHL 86 F +AL P+T+NLY + + + +L Sbjct: 252 FGMALSPLTQNLYYSALSSHNL 273 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 25.0 bits (52), Expect = 0.66 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 21 FKLALHPITKNLYVTVIGARHL 86 F +AL P+T NLY + + +R L Sbjct: 255 FGMALSPMTNNLYYSPLSSRSL 276 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 21 FKLALHPITKNLYVTVIGARHL 86 F +AL P+T NLY + + + L Sbjct: 255 FGMALSPVTNNLYYSPLTSHSL 276 >M12598-1|AAA27733.1| 77|Apis mellifera protein ( Bee preprosecapin mRNA, complete cds. ). Length = 77 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -1 Query: 527 VKIPSGCPYGPSFFQNR 477 + +P CP G F +NR Sbjct: 55 IDVPPRCPPGSKFIKNR 71 >AY082691-1|AAL92482.1| 77|Apis mellifera preprosecapin protein. Length = 77 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -1 Query: 527 VKIPSGCPYGPSFFQNR 477 + +P CP G F +NR Sbjct: 55 IDVPPRCPPGSKFIKNR 71 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 195 WNEDFKFQLKQKEAKKSSDKIDLQNLV 275 W+ D+ + +K+ KSS L+N+V Sbjct: 200 WDSDYTDKSNEKKIPKSSGWRKLRNIV 226 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 27 LALHPITKNLYVTVIGARHL 86 +AL P+T NLY + + + L Sbjct: 254 MALSPVTNNLYYSPLASHGL 273 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 27 LALHPITKNLYVTVIGARHL 86 +AL P+T NLY + + + L Sbjct: 256 MALSPMTNNLYYSPVASTSL 275 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 27 LALHPITKNLYVTVIGARHL 86 +AL P+T NLY + + + L Sbjct: 256 MALSPMTNNLYYSPVASTSL 275 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 27 LALHPITKNLYVTVIGARHL 86 +AL P+T NLY + + + L Sbjct: 256 MALSPMTNNLYYSPVASTSL 275 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,334 Number of Sequences: 438 Number of extensions: 4393 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -