BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0588 (677 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g04220.2 68418.m00411 C2 domain-containing protein (sytC) GC ... 36 0.025 At5g04220.1 68418.m00410 C2 domain-containing protein (sytC) GC ... 36 0.025 At2g20990.1 68415.m02485 C2 domain-containing protein (sytA) sim... 35 0.043 At5g11100.1 68418.m01296 C2 domain-containing protein similar to... 35 0.057 At1g20080.1 68414.m02513 C2 domain-containing protein contains I... 33 0.17 At2g05645.1 68415.m00604 hypothetical protein 32 0.30 At2g21010.1 68415.m02489 C2 domain-containing protein contains I... 31 0.53 At5g25070.1 68418.m02971 expressed protein 31 0.70 At1g05500.1 68414.m00561 C2 domain-containing protein similar to... 31 0.93 At4g13550.1 68417.m02112 lipase class 3 family protein very low ... 30 1.2 At4g00700.1 68417.m00096 C2 domain-containing protein contains I... 30 1.2 At2g21040.1 68415.m02495 C2 domain-containing protein low simila... 30 1.2 At3g19830.1 68416.m02512 C2 domain-containing protein low simila... 30 1.6 At2g38440.1 68415.m04721 expressed protein 29 2.1 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 29 2.1 At5g58900.1 68418.m07379 myb family transcription factor contain... 29 2.8 At4g28230.1 68417.m04045 expressed protein 29 2.8 At5g58690.1 68418.m07353 phosphoinositide-specific phospholipase... 29 3.7 At5g58670.1 68418.m07351 phosphoinositide-specific phospholipase... 29 3.7 At5g50170.1 68418.m06213 C2 domain-containing protein / GRAM dom... 29 3.7 At2g20000.1 68415.m02338 cell division cycle family protein / CD... 29 3.7 At2g17580.1 68415.m02034 polynucleotide adenylyltransferase fami... 29 3.7 At5g26260.1 68418.m03133 meprin and TRAF homology domain-contain... 28 4.9 At4g32900.2 68417.m04682 expressed protein 28 4.9 At4g32900.1 68417.m04681 expressed protein 28 4.9 At2g40116.1 68415.m04933 phosphoinositide-specific phospholipase... 28 4.9 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 28 4.9 At5g55720.1 68418.m06946 pectate lyase family protein similar to... 28 6.5 At5g26320.1 68418.m03146 meprin and TRAF homology domain-contain... 28 6.5 At3g62890.1 68416.m07065 pentatricopeptide (PPR) repeat-containi... 27 8.6 At3g52230.1 68416.m05739 expressed protein 27 8.6 At3g11520.1 68416.m01404 cyclin, putative (CYC2) similar to cycl... 27 8.6 At1g56660.1 68414.m06516 expressed protein 27 8.6 At1g27720.1 68414.m03388 transcription initiation factor IID (TF... 27 8.6 >At5g04220.2 68418.m00411 C2 domain-containing protein (sytC) GC donor splice site at exon 3; similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 540 Score = 35.9 bits (79), Expect = 0.025 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +3 Query: 108 RAHGYLVKVKVFPGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSG-H 284 + H V +F GE K L++ P WNE+F+F L++ K+S ++++ + +G H Sbjct: 436 KKHSNPYAVVLFRGEKKKTKMLKKTRDPRWNEEFQFTLEEPPVKESI-RVEVMSKGTGFH 494 Query: 285 FLS 293 F S Sbjct: 495 FRS 497 Score = 29.1 bits (62), Expect = 2.8 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 3/127 (2%) Frame = +3 Query: 54 LYVTVIGARHLPSLFGLSRAHGYLVKVKVFPGE---SKYETTLQENSWPVWNEDFKFQLK 224 L+V+++ AR+L L + Y VK+ + GE +K T + N P WNE FK +K Sbjct: 263 LHVSILRARNLLKKDLLGTSDPY-VKLSL-TGEKLPAKKTTIKKRNLNPEWNEHFKLIVK 320 Query: 225 QKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTIDTKNAKVGDQEEPK 404 ++ ++ + V GH ++ K +RK KN+ V K Sbjct: 321 DPNSQVLQLEVFDWDKVGGH--DRLGMQMIPLQKINPGERKEFNLDLIKNSNVVMDSGDK 378 Query: 405 AKTGFLE 425 K G LE Sbjct: 379 KKRGRLE 385 >At5g04220.1 68418.m00410 C2 domain-containing protein (sytC) GC donor splice site at exon 3; similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 318 Score = 35.9 bits (79), Expect = 0.025 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +3 Query: 108 RAHGYLVKVKVFPGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSG-H 284 + H V +F GE K L++ P WNE+F+F L++ K+S ++++ + +G H Sbjct: 214 KKHSNPYAVVLFRGEKKKTKMLKKTRDPRWNEEFQFTLEEPPVKESI-RVEVMSKGTGFH 272 Query: 285 FLS 293 F S Sbjct: 273 FRS 275 Score = 29.1 bits (62), Expect = 2.8 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 3/127 (2%) Frame = +3 Query: 54 LYVTVIGARHLPSLFGLSRAHGYLVKVKVFPGE---SKYETTLQENSWPVWNEDFKFQLK 224 L+V+++ AR+L L + Y VK+ + GE +K T + N P WNE FK +K Sbjct: 41 LHVSILRARNLLKKDLLGTSDPY-VKLSL-TGEKLPAKKTTIKKRNLNPEWNEHFKLIVK 98 Query: 225 QKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTIDTKNAKVGDQEEPK 404 ++ ++ + V GH ++ K +RK KN+ V K Sbjct: 99 DPNSQVLQLEVFDWDKVGGH--DRLGMQMIPLQKINPGERKEFNLDLIKNSNVVMDSGDK 156 Query: 405 AKTGFLE 425 K G LE Sbjct: 157 KKRGRLE 163 >At2g20990.1 68415.m02485 C2 domain-containing protein (sytA) similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 541 Score = 35.1 bits (77), Expect = 0.043 Identities = 28/116 (24%), Positives = 56/116 (48%), Gaps = 6/116 (5%) Frame = +3 Query: 126 VKVKVFPGE--SKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKI-DLQNLVSGHFLSL 296 VK+K+ + SK T +N P WNE+FKF ++ + + + D + + + + + Sbjct: 285 VKIKLSEDKIPSKKTTVKHKNLNPEWNEEFKFSVRDPQTQVLEFSVYDWEQVGNPEKMGM 344 Query: 297 TIYAILE--PPKQEADKRKNSKTID-TKNAKVGDQEEPKAKTGFLEKTFSSFKATK 455 + A+ E P + +A + KT+D ++ + D+ K + L K F+ + K Sbjct: 345 NVLALKEMVPDEHKAFTLELRKTLDGGEDGQPPDKYRGKLEVELLYKPFTEEEMPK 400 Score = 31.5 bits (68), Expect = 0.53 Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 8/89 (8%) Frame = +3 Query: 141 FPGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSL-----TI- 302 F GE + +++N P WNE+F F L++ + +K+ ++ L + + L T+ Sbjct: 446 FKGEERKTKHVKKNRDPRWNEEFTFMLEEPPVR---EKLHVEVLSTSSRIGLLHPKETLG 502 Query: 303 YAILEPPKQEADKRKNSK--TIDTKNAKV 383 Y + +KR N K ID+KN K+ Sbjct: 503 YVDIPVVDVVNNKRMNQKFHLIDSKNGKI 531 >At5g11100.1 68418.m01296 C2 domain-containing protein similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 574 Score = 34.7 bits (76), Expect = 0.057 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = +3 Query: 27 LALHPITKNLYVTVIGARHLPSLFGLSRAHGY-LVKVKVFPGESKYETTLQENSWPVWNE 203 L L P+ K L V V+ A+ L + + ++ Y +V ++ P +K T+ + P+WNE Sbjct: 265 LELKPVGK-LDVKVVQAKDLANKDMIGKSDPYAIVFIRPLPDRTKKTKTISNSLNPIWNE 323 Query: 204 DFKF 215 F+F Sbjct: 324 HFEF 327 Score = 34.3 bits (75), Expect = 0.075 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +3 Query: 54 LYVTVIGARHLPSLFGLSRAHGYLVKVKVFPGESKYETTLQENSW-PVWNEDFKF 215 L VTV+ A LP++ + +A ++V + + E+K +T + +S PVWN+ F F Sbjct: 450 LSVTVVAAEDLPAVDFMGKADAFVV-ITLKKSETKSKTRVVPDSLNPVWNQTFDF 503 >At1g20080.1 68414.m02513 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 535 Score = 33.1 bits (72), Expect = 0.17 Identities = 23/88 (26%), Positives = 44/88 (50%), Gaps = 6/88 (6%) Frame = +3 Query: 138 VFPGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSG----HFLSLTIY 305 +F GE + +++N P W+EDF+F L + +DK+ ++ + S H Y Sbjct: 441 LFRGEERKTKRVKKNREPRWDEDFQFPLDEPPI---NDKLHVEVISSSSRLIHPKETLGY 497 Query: 306 AILEPPKQEADKRKNSK--TIDTKNAKV 383 ++ +++R N K ID+KN ++ Sbjct: 498 VVINLGDVVSNRRINDKYHLIDSKNGRI 525 >At2g05645.1 68415.m00604 hypothetical protein Length = 204 Score = 32.3 bits (70), Expect = 0.30 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 431 CFLQKTCFSFGFLLISYFCIFSIYCLTVFTFVGFL 327 C L C+S+GFL + F + + Y T+ FV F+ Sbjct: 67 CILALACWSYGFLCVELFALRTTYSHTLKAFVHFV 101 >At2g21010.1 68415.m02489 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 256 Score = 31.5 bits (68), Expect = 0.53 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 5/86 (5%) Frame = +3 Query: 141 FPGESKYETTLQENSWPVWNEDFKFQLKQKEA-KKSSDKIDLQNLVSGHFLSLTIYAILE 317 F GE + +++N P WNE+F F L++ +K ++ + G ++ Sbjct: 161 FKGEERKTKNVKKNKDPKWNEEFSFMLEEPPVHEKLHVEVFSTSSRIGLLHPKETLGYVD 220 Query: 318 PPKQEA--DKRKNSK--TIDTKNAKV 383 P + +KR N K ID+KN K+ Sbjct: 221 IPVVDVVNNKRMNQKFHLIDSKNGKI 246 Score = 30.7 bits (66), Expect = 0.93 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 3/94 (3%) Frame = +3 Query: 153 SKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGH-FLSLTIYAI--LEPP 323 SK T +N P WNE+FKF ++ + + + + H + + + A+ L P Sbjct: 19 SKKTTVKHKNLNPEWNEEFKFSVRDPKTQVLEFNVYGWEKIGKHDKMGMNVLALKELAPD 78 Query: 324 KQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLE 425 +++A + KT+D G++ +P G LE Sbjct: 79 ERKAFTLELRKTLDG-----GEEGQPGKYRGKLE 107 >At5g25070.1 68418.m02971 expressed protein Length = 736 Score = 31.1 bits (67), Expect = 0.70 Identities = 28/95 (29%), Positives = 48/95 (50%) Frame = +3 Query: 219 LKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTIDTKNAKVGDQEE 398 LK++ +KKS I QN+ S F+ ++ P+ EA+K+ + T +N K + Sbjct: 540 LKERSSKKS---IIQQNITS--FMDKIMFIEKRMPELEAEKKVAAST---RNFKEAGRIA 591 Query: 399 PKAKTGFLEKTFSSFKATKAEAIAQKSILEKRRTV 503 +AK+ LEK + + KA A +K+ E T+ Sbjct: 592 AEAKSLNLEKDKTQMETGKANAELEKAEHEIEETI 626 >At1g05500.1 68414.m00561 C2 domain-containing protein similar to Ca2+-dependent lipid-binding protein (CLB1) GI:2789434 from [Lycopersicon esculentum] Length = 528 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = +3 Query: 54 LYVTVIGARHLPSLFGLSRAHGYLVKVKVFPGESKYETTLQENSWPVWNEDFKF 215 L VTVI A +P + +A Y+V G + ++ PVWN+ F F Sbjct: 405 LSVTVISAEEIPIQDLMGKADPYVVLSMKKSGAKSKTRVVNDSLNPVWNQTFDF 458 >At4g13550.1 68417.m02112 lipase class 3 family protein very low similarity to diacylglycerol lipase [Aspergillus oryzae] GI:1772352; contains Pfam profiles PF01764: Lipase (class 3), PF00168: C2 domain Length = 785 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +3 Query: 189 PVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGH 284 P WNEDF F +K AKK NLV+ H Sbjct: 116 PKWNEDFVFNIKLPPAKKIEIAAWDANLVTPH 147 >At4g00700.1 68417.m00096 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1006 Score = 30.3 bits (65), Expect = 1.2 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +3 Query: 48 KNLYVTVIGARHLPSLFGLSRAHGYLVKVKVFPGESKYETT-LQENSWPVWNEDFKF 215 K LYV V+ AR LP+ Y+V VK+ G K TT +N+ P WN+ F F Sbjct: 268 KFLYVRVVKARDLPNKDLTGSLDPYVV-VKI--GNFKGVTTHFNKNTDPEWNQVFAF 321 >At2g21040.1 68415.m02495 C2 domain-containing protein low similarity to phloem protein [Cucurbita maxima] GI:4164541; contains Pfam profile PF00168: C2 domain Length = 261 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 141 FPGESKYETTLQENSWPVWNEDFKFQLKQ 227 F GE + +++N P WNE+F F L++ Sbjct: 42 FKGEERKTKHVKKNKDPKWNEEFSFMLEE 70 >At3g19830.1 68416.m02512 C2 domain-containing protein low similarity to GLUT4 vesicle protein [Rattus norvegicus] GI:4193489; contains Pfam profile PF00168: C2 domain Length = 666 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = +3 Query: 54 LYVTVIGARHLPSLFGLSRAHGYLVKV--KVFPGESKYETT-LQENSWPVWNEDFKF 215 L VT++ A+ LP +F ++++ +V + +TT + P+WN+DF+F Sbjct: 388 LSVTLVNAQKLPYMFSGKTDPYVILRIGDQVIRSKKNSQTTVIGAPGQPIWNQDFQF 444 >At2g38440.1 68415.m04721 expressed protein Length = 1399 Score = 29.5 bits (63), Expect = 2.1 Identities = 34/145 (23%), Positives = 59/145 (40%) Frame = +3 Query: 96 FGLSRAHGYLVKVKVFPGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLV 275 F +S A G +K P + ET+ E SW + K Q ++ A + + +N + Sbjct: 149 FDISGA-GACLKRYTDPSFVRLETSSYEESWDDIQREKKSQKAKRRASQWRNGGTPENAL 207 Query: 276 SGHFLSLTIYAILEPPKQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFSSFKATK 455 S H ++ + EA ++ + K K+ D +K+G E F T+ Sbjct: 208 SSH---AKLHELFLEEHLEAHHSDPARVVKLKTRKL-DGCSLISKSG--ESYMEKFVQTR 261 Query: 456 AEAIAQKSILEKRRTVGAATWNFDS 530 ++ I+ + G TWN DS Sbjct: 262 VDSKISYEII--TQNPGLLTWNMDS 284 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 29.5 bits (63), Expect = 2.1 Identities = 22/80 (27%), Positives = 37/80 (46%) Frame = +3 Query: 321 PKQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFSSFKATKAEAIAQKSILEKRRT 500 PK+E+ ++K I K A+ GD +P AK + T A+ I +K I+ +R Sbjct: 789 PKEESTGTSSNKKIVKKVAETGDTSDPSAKAN---------EQTPAKTIVKKKII--KRV 837 Query: 501 VGAATWNFDSKLFQNDLKNG 560 D+K+ + K+G Sbjct: 838 AKRKVAEIDNKMDGDSKKDG 857 >At5g58900.1 68418.m07379 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 288 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 510 ATWNF-DSKLFQNDLKNGLIGTPDIWRPINAIASGITASE 626 ATW ++K F+N L TPD W+ + A+ G T S+ Sbjct: 32 ATWTAAENKAFENALAVYDDNTPDRWQKVAAVIPGKTVSD 71 >At4g28230.1 68417.m04045 expressed protein Length = 402 Score = 29.1 bits (62), Expect = 2.8 Identities = 33/123 (26%), Positives = 51/123 (41%), Gaps = 2/123 (1%) Frame = +3 Query: 147 GESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPP- 323 G+S+ + ++ +SW NE F ++ S LQ+ VS I E P Sbjct: 27 GDSQITSAIEASSWSHLNESFDSDCSKENQFPISVSSSLQSSVS----------ITEAPS 76 Query: 324 -KQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFSSFKATKAEAIAQKSILEKRRT 500 K + K K++ K + EE + + G L S + KAE A +SI + R Sbjct: 77 AKSKTVKTKSAADRSKKRDIDAEIEEVEKEIGRLSTKLESLRLEKAEQTA-RSIAIRGRI 135 Query: 501 VGA 509 V A Sbjct: 136 VPA 138 >At5g58690.1 68418.m07353 phosphoinositide-specific phospholipase C family protein contains Pfam profile: PF00388 phosphatidylinositol-specific phospholipase C Length = 578 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +3 Query: 162 ETTLQENSW-PVWNEDFKFQLKQKE 233 +T ++ +W P WNE+F+FQL E Sbjct: 495 KTKKEQKTWEPFWNEEFEFQLTVPE 519 >At5g58670.1 68418.m07351 phosphoinositide-specific phospholipase C (PLC1) identical to phosphoinositide specific phospholipase C [Arabidopsis thaliana] GI:902923 Length = 561 Score = 28.7 bits (61), Expect = 3.7 Identities = 9/28 (32%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +3 Query: 153 SKYETTLQENSW-PVWNEDFKFQLKQKE 233 + Y T + ++ W P+W+++F+F L+ E Sbjct: 473 ASYRTEIDKDEWFPIWDKEFEFPLRVPE 500 >At5g50170.1 68418.m06213 C2 domain-containing protein / GRAM domain-containing protein low similarity to SP|P40748 Synaptotagmin III (SytIII) {Rattus norvegicus}; contains Pfam profiles PF00168: C2 domain, PF02893: GRAM domain Length = 1027 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +3 Query: 54 LYVTVIGARHLPSLFGLSRAHGYLVKVKVFPGESKYETTL-QENSWPVWNEDFKFQL 221 LYV ++ A+ LP+ ++ H G K +T + ++ S P+WNE+F F++ Sbjct: 3 LYVYILQAKDLPAKETFAKLH---------VGRHKSKTRVARDTSSPIWNEEFVFRI 50 >At2g20000.1 68415.m02338 cell division cycle family protein / CDC family protein low similarity to SP|P30260|CC27_HUMAN Protein CDC27Hs (Cell division cycle protein 27 homolog) Homo sapiens; contains Pfam profile PF00515: TPR Domain Length = 744 Score = 28.7 bits (61), Expect = 3.7 Identities = 23/88 (26%), Positives = 40/88 (45%) Frame = +3 Query: 258 DLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFS 437 ++ N +GH+L IY + K A + K S TID + E G E+ + Sbjct: 96 EIPNGAAGHYLLGLIYKYTDRRKNAAQQFKQSLTID---PLLWAAYEELCILGAAEEATA 152 Query: 438 SFKATKAEAIAQKSILEKRRTVGAATWN 521 F T A +I ++ + + ++G T+N Sbjct: 153 VFGETAALSIQKQYMQQLSTSLGLNTYN 180 >At2g17580.1 68415.m02034 polynucleotide adenylyltransferase family protein similar to SP|P13685 Poly(A) polymerase (EC 2.7.7.19) {Escherichia coli O157:H7}; contains Pfam profile PF01743: polyA polymerase family protein Length = 757 Score = 28.7 bits (61), Expect = 3.7 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = +3 Query: 309 ILEPPKQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFL-EKTFSSFKATKAEAIAQKSIL 485 I E PKQ+ K + ++ K+ + +E +AK GF+ +K+ S ++ Q S Sbjct: 676 ICELPKQKTSKNHSKESRKVKHNDLPVKEIKEAKQGFVSDKSMSDLLQVLEKSSQQVSSK 735 Query: 486 EKRRTVGAATWNFDSKL 536 E+ ++ + N KL Sbjct: 736 EENNSLSSEKTNRPRKL 752 >At5g26260.1 68418.m03133 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 351 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = -3 Query: 600 SHLWASICLEFQSNRSSNHFEII*SQNSKWLPLRS 496 ++ W ++ L ++ RSSNH ++ ++ W P+RS Sbjct: 275 TNTWGAVNLRLKNQRSSNHKQL---YSAAWYPIRS 306 >At4g32900.2 68417.m04682 expressed protein Length = 139 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/65 (26%), Positives = 28/65 (43%) Frame = +3 Query: 186 WPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTID 365 WP + Q ++E K S +NL+ G + I IL+ +Q K S+ + Sbjct: 2 WPSSRNSSQPQAMRQEKKSISVSFRAENLIPGVVIGFIIGMILDLSQQVTSPVKRSRLLS 61 Query: 366 TKNAK 380 +K K Sbjct: 62 SKVQK 66 >At4g32900.1 68417.m04681 expressed protein Length = 143 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/65 (26%), Positives = 28/65 (43%) Frame = +3 Query: 186 WPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLTIYAILEPPKQEADKRKNSKTID 365 WP + Q ++E K S +NL+ G + I IL+ +Q K S+ + Sbjct: 2 WPSSRNSSQPQAMRQEKKSISVSFRAENLIPGVVIGFIIGMILDLSQQVTSPVKRSRLLS 61 Query: 366 TKNAK 380 +K K Sbjct: 62 SKVQK 66 >At2g40116.1 68415.m04933 phosphoinositide-specific phospholipase C family protein contains Pfam profile: PF00388 phosphatidylinositol-specific phospholipase C Length = 613 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/28 (39%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +3 Query: 153 SKYETTLQENSW-PVWNEDFKFQLKQKE 233 +K +T + E++W P+W+E+F F L E Sbjct: 527 AKKKTKIIEDNWYPIWDEEFSFPLTVPE 554 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 600 SHLWASICLEFQSNRSSNHFEII*SQNSKWLPLRS 496 ++ W ++ L ++ RSSNH +I ++ W P RS Sbjct: 344 TNTWGAVNLRLKNQRSSNHAQI---YSAAWYPTRS 375 >At5g55720.1 68418.m06946 pectate lyase family protein similar to pectate lyase 1 GP:6606532 from [Musa acuminata] Length = 392 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = +3 Query: 144 PGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQ--NLVSGHFLSLTIYAI 311 PG +Y T + W +++ D QLKQ S ID + N+ + LT+Y + Sbjct: 103 PGTLRYAATQDQPLWIIFDRDMVIQLKQDLQVASYKTIDGRGNNVQIAYGPCLTLYKV 160 >At5g26320.1 68418.m03146 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 352 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -3 Query: 600 SHLWASICLEFQSNRSSNHFEII*SQNSKWLPLRS 496 ++ W S+ L+ ++ RSSNH ++ + W +RS Sbjct: 276 TNTWGSVNLQLKNQRSSNHIQL---YSEAWCAIRS 307 >At3g62890.1 68416.m07065 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 558 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 675 VQKGPLPVAFKGFHPVFHLR*FHLQSHLWASICLEFQSNRSS 550 + KG +A+ +P+FH+R L+S LW I N SS Sbjct: 1 MSKGAAIIAYA--NPIFHIRHLKLESFLWNIIIRAIVHNVSS 40 >At3g52230.1 68416.m05739 expressed protein Length = 145 Score = 27.5 bits (58), Expect = 8.6 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 1/84 (1%) Frame = +3 Query: 144 PGESKYETTLQENSWPVWNEDFKFQLKQKEAKKSSDKIDLQNLVSGHFLSLT-IYAILEP 320 P +S YET + P E KF+ + + S+ I Q G FL L +A Sbjct: 55 PLKSTYETVTFPYNPPKSAEPIKFEAEPSSGRTSNSVILWQVYALGGFLVLKWAWARWNE 114 Query: 321 PKQEADKRKNSKTIDTKNAKVGDQ 392 + +DK++ + D K+ DQ Sbjct: 115 RNERSDKKEATGDDDQKDDDEDDQ 138 >At3g11520.1 68416.m01404 cyclin, putative (CYC2) similar to cyclin [Arabidopsis thaliana] GI:1360646; contains Pfam profiles PF00134: Cyclin, N-terminal domain, PF02984: Cyclin, C-terminal domain; identical to cDNA cyclin box (cyc2) partial cds GI:456019 Length = 414 Score = 27.5 bits (58), Expect = 8.6 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 3/81 (3%) Frame = +3 Query: 324 KQEADKRKNSKTIDTKNAKVGDQEEPKAKTGFLEKTFSSFKATKAEAIAQK---SILEKR 494 K DKR+ SK I+ E KAK + T+SS +++A ++ ++K Sbjct: 92 KARGDKREPSKPIEVIVISPDTNEVAKAKENKKKVTYSSVLDARSKAASKTLDIDYVDKE 151 Query: 495 RTVGAATWNFDSKLFQNDLKN 557 + A + D +F ++ N Sbjct: 152 NDLAAVEYVEDMYIFYKEVVN 172 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 324 KQEADKRKNSKTIDTKNAKVGDQEEPK 404 K++ DK+KN K DTK K+ + EE K Sbjct: 430 KKKKDKKKNKKK-DTKEPKMTEDEEEK 455 >At1g27720.1 68414.m03388 transcription initiation factor IID (TFIID) component TAF4 family protein contains Pfam profile PF05236: Transcription initiation factor TFIID component TAF4 family Length = 682 Score = 27.5 bits (58), Expect = 8.6 Identities = 23/71 (32%), Positives = 30/71 (42%) Frame = -2 Query: 592 MGLHMSGVPIKPFFKSF*NNLESKFQVAAPTVRRFSKIDFCAIASAFVALKLLNVFSRKP 413 MGL S F S L+S V P IA+ V K+ +V +KP Sbjct: 354 MGLFTSTTSASSVFPSMTTQLDSSTMVNMPAPSE----TIPKIANVTVTPKMPSVGQKKP 409 Query: 412 VLALGSS*SPT 380 + ALGSS P+ Sbjct: 410 LEALGSSLPPS 420 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,997,166 Number of Sequences: 28952 Number of extensions: 312328 Number of successful extensions: 927 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 889 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -