BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0587 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_16769| Best HMM Match : DUF1690 (HMM E-Value=0.17) 29 4.3 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -1 Query: 650 AESALFMLVLFGVQRIF--LYCLQHRRHSYKRYKLTHKLFWLL 528 A +A F LVL ++R++ LY LQHR+ + Y ++ L WL+ Sbjct: 251 ASAANFSLVLVSLERLYVTLYPLQHRKTRTRSYLISIALTWLI 293 >SB_16769| Best HMM Match : DUF1690 (HMM E-Value=0.17) Length = 837 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 335 LGQIFKGKMR*FPLLCYKCTVDY 267 +G+IF+ ++R FP L CT+D+ Sbjct: 3 IGEIFRARLRQFPSLVNCCTIDW 25 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,462,451 Number of Sequences: 59808 Number of extensions: 288903 Number of successful extensions: 609 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -