BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0587 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF269155-1|AAF91400.1| 59|Anopheles gambiae transcription fact... 26 1.2 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 4.8 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 6.3 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.4 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 8.4 >AF269155-1|AAF91400.1| 59|Anopheles gambiae transcription factor Deformed protein. Length = 59 Score = 25.8 bits (54), Expect = 1.2 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -3 Query: 168 YTKYDVLQL*KKKHY*QMNIQLEIRKKKTITDRVFRDYRQTKIF 37 YT++ +L+L K+ HY N L R++ I + RQ KI+ Sbjct: 8 YTRHQILELEKEFHY---NXYLTRRRRIEIAHTLVLSERQIKIW 48 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.8 bits (49), Expect = 4.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 596 YCLQHRRHSYKRYKLTH 546 YC + +H++KRYK H Sbjct: 1993 YCARLIQHAWKRYKQRH 2009 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +1 Query: 37 ENFSLSIVAKYTICDCFFLPYFQL 108 E + ++++ K T C C+ P + L Sbjct: 72 EGYVIAVINKITFCSCYAPPRWDL 95 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 8.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -2 Query: 154 CFTIIKKKTLLTNEHTTGNKEEKNN 80 C+T + T+LT + T N +EK++ Sbjct: 952 CYTTVIPHTVLTQYNYTVNTDEKDS 976 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.0 bits (47), Expect = 8.4 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -2 Query: 145 IIKKKTLLTNEHTTGNKEEKNNHRSCISRL*TN*NFLL 32 +++ K L N +N HRSC+S L + FLL Sbjct: 926 LLEPKVSLENPSVNWRLLWRNIHRSCLSSLQRSTLFLL 963 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 590,101 Number of Sequences: 2352 Number of extensions: 10998 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -