BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0586 (767 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31333| Best HMM Match : DM (HMM E-Value=7.3) 28 9.5 SB_10899| Best HMM Match : PAN (HMM E-Value=0.0019) 28 9.5 >SB_31333| Best HMM Match : DM (HMM E-Value=7.3) Length = 127 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -3 Query: 597 TGRAPGQQRSTVNCYQR*AFNFRIHRDHISSVPCALSTLIC 475 T R P Q++T++C Q +F R R H + PC + +C Sbjct: 69 THRKPNIQKATISCTQLSSFKRRGGRSHARN-PCTVVNDMC 108 >SB_10899| Best HMM Match : PAN (HMM E-Value=0.0019) Length = 190 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -3 Query: 267 VFKNIRKVVPTIHLNTHTRTICIQCMVY 184 + +NI VP+ H HTRT+ + C+V+ Sbjct: 103 LLQNIVPSVPSNHRTLHTRTMEVACVVF 130 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,463,845 Number of Sequences: 59808 Number of extensions: 507233 Number of successful extensions: 926 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 856 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 922 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2083999566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -