BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0584 (462 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 24 0.60 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 24 0.60 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 1.4 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 2.4 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 7.4 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 24.2 bits (50), Expect = 0.60 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 249 GNGRNWSSCFRTKKPGHMH*RNDF 320 GN ++W+ F+ K G+ R DF Sbjct: 190 GNAKHWTGIFQKKWRGYEDFRRDF 213 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 24.2 bits (50), Expect = 0.60 Identities = 8/30 (26%), Positives = 18/30 (60%) Frame = -2 Query: 458 YVPRRLQFQMSQDVLRQNEVLSQISAIFYL 369 +VPRR+ F + ++ R+N + + +F + Sbjct: 331 FVPRRVPFDLFENKKRKNNIKLYVRRVFIM 360 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 23.0 bits (47), Expect = 1.4 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -1 Query: 459 IRPSSSTVPNVTGRPSSKRGIVTNIRDFLPDLC 361 + P V VT +PSS + RD LC Sbjct: 390 VEPVPQPVEEVTQKPSSTKAPAPPSRDLTTTLC 422 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 2.4 Identities = 10/46 (21%), Positives = 20/46 (43%) Frame = -2 Query: 287 LRSETRTPVPPIASPRGDYSSLRDRANSTPNNMTIEKIARFRTTFP 150 ++S+ P P I SP +S ++ PN+ + + + P Sbjct: 412 MQSQIINPQPQITSPSNTNTSTSSTNSNKPNSSDLNMLIKETMPLP 457 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 20.6 bits (41), Expect = 7.4 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = +2 Query: 257 AELEFVFPNEEARSYALEKRFYVPGSSVPIDVDVQHKSGKK 379 A E + + +S E R SSV ++D++ K +K Sbjct: 37 ARFETLVVKQTKQSVLDEARLRANDSSVDPEIDIEDKPAQK 77 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,676 Number of Sequences: 336 Number of extensions: 2497 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10616413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -