BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0580 (554 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58554| Best HMM Match : TAF (HMM E-Value=7.9) 30 1.5 SB_57096| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_55267| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_51621| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_14515| Best HMM Match : ScdA_N (HMM E-Value=6.1) 27 7.8 SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) 23 8.5 >SB_58554| Best HMM Match : TAF (HMM E-Value=7.9) Length = 321 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = +3 Query: 216 LKETLPDALEHECVKCTGKQKSGADKVIRHLVNKRPDLWKELAVKYDPDNIY 371 L E +PD ++H +K +K ++V R P W+E DP+ Y Sbjct: 18 LDEDIPDDVKHRLLKPPVPEKVWTEEVWREFDPLLPGRWQEGPESLDPETYY 69 >SB_57096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 28.3 bits (60), Expect = 4.5 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -2 Query: 325 SGRLFTKCLMTLSAPDFCFPVHLTHSCSRASGRVSFKALPSG 200 SGRL ++ L + P C P S SGR+ + LPSG Sbjct: 237 SGRLPSRWLPSRRLPSGCLPSRRLPSGRLPSGRLPSRRLPSG 278 >SB_55267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 72 VTWARPESTYTDKWDNINVDEILESNRLLKGYVDC 176 + W+ E Y ++ + NV ++ SNRL VDC Sbjct: 225 LAWSHGECRYCNRVISANVSDLRISNRLSVNVVDC 259 >SB_51621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 510 Score = 27.5 bits (58), Expect = 7.8 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +3 Query: 276 KSGADKVIRHLVNKRPDLWKELAVKYDPDNIYQARYKDKIDAV 404 +SG + +KR W+E+ Y+ DN+Y + + D V Sbjct: 86 ESGTKNIFGGYSSKRMKDWQEIIRLYEKDNVYLGEFDECQDIV 128 >SB_14515| Best HMM Match : ScdA_N (HMM E-Value=6.1) Length = 609 Score = 27.5 bits (58), Expect = 7.8 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = +3 Query: 216 LKETLPDALEHECVKCTGKQKSGADKVIRHLVNKRPDLWKELAVKYDPDNIY 371 L E +PD ++H +K K +V R P W+E DP+ Y Sbjct: 29 LDEDIPDDVKHRLLKPLVPAKVWTKEVWREFDPLLPGRWQEGPESLDPEKYY 80 >SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) Length = 685 Score = 23.0 bits (47), Expect(2) = 8.5 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -1 Query: 62 CHHYYDQYFH 33 CHHYY Y++ Sbjct: 521 CHHYYYYYYY 530 Score = 22.6 bits (46), Expect(2) = 8.5 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = -1 Query: 59 HHYYDQYFHCRLLIIYPVS 3 ++YY Y++ R ++ YPV+ Sbjct: 530 YYYYYYYYYPRQVVRYPVN 548 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,130,404 Number of Sequences: 59808 Number of extensions: 315926 Number of successful extensions: 806 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1288581898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -