BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0579 (585 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0914 - 7693305-7693513,7693613-7694111,7694716-7696316,769... 29 2.7 11_06_0032 + 19432305-19432510,19433390-19434326,19434880-194349... 28 6.3 06_03_0901 - 25800317-25800403,25800420-25800674,25800817-258010... 28 6.3 02_04_0480 - 23274945-23275196,23275558-23275623,23276709-232768... 28 6.3 09_04_0301 + 16498346-16498501,16498805-16499274,16500023-16500131 27 8.3 07_01_0713 - 5438005-5438294,5438441-5438567,5438638-5438687,543... 27 8.3 01_06_1397 - 37017468-37017561,37017763-37017836,37019128-370191... 27 8.3 >07_01_0914 - 7693305-7693513,7693613-7694111,7694716-7696316, 7696509-7696530 Length = 776 Score = 29.1 bits (62), Expect = 2.7 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = -2 Query: 326 SLPVDCSR*TPYRLGKVSQLYHHPCIHNICHTVRRQQSIHLQDISS*SPGQPRSLLWHEL 147 ++ V+ ++ + +G S + + + N+ H V +Q+ D SS PG H + Sbjct: 393 TMAVEIAQGSRQAIGVTSMAFLYRALDNVYHQVAARQA-SASDCSSFVPG-------HFI 444 Query: 146 GGWQASFW 123 GW ASFW Sbjct: 445 MGWFASFW 452 >11_06_0032 + 19432305-19432510,19433390-19434326,19434880-19434975, 19435518-19435654,19435888-19436056 Length = 514 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 500 GLVYNDKTGICTWPDEAKKKGCGAAEV 580 G Y + IC PD AK +GC EV Sbjct: 110 GSAYGGQRSICCTPDLAKLEGCKQGEV 136 >06_03_0901 - 25800317-25800403,25800420-25800674,25800817-25801043, 25801773-25801929,25802977-25803159 Length = 302 Score = 27.9 bits (59), Expect = 6.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -2 Query: 266 YHHPCIHNICHTVRRQQSIHLQDISS*SPGQPRSLL 159 +HHP + C + R++ HL +SS PG LL Sbjct: 29 HHHPAKRS-CRSPHRRREAHLHHLSSLFPGMDPQLL 63 >02_04_0480 - 23274945-23275196,23275558-23275623,23276709-23276851, 23276947-23277063,23277219-23278683,23279561-23280730 Length = 1070 Score = 27.9 bits (59), Expect = 6.3 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = -3 Query: 373 KLGSLRAVQVER*ITFLFLWTVVVEHHTV-WAKFLNYITTPAFIIFVTLFGV 221 K +R V+ + F W V H + W +FL + TP V +FG+ Sbjct: 416 KCSKIRLSVVDGSLAFYEGWNSFVSEHCIKWGEFLLFEYTPESTFSVRVFGI 467 >09_04_0301 + 16498346-16498501,16498805-16499274,16500023-16500131 Length = 244 Score = 27.5 bits (58), Expect = 8.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 395 GGKVEVFEAWVSESSPG*KVNHISLP 318 GGK E + WV++ PG + +SLP Sbjct: 172 GGKEEDAKEWVAQVEPGVLITFVSLP 197 >07_01_0713 - 5438005-5438294,5438441-5438567,5438638-5438687, 5439119-5439426,5439581-5439673,5439840-5440197, 5440235-5440267,5440324-5440482,5440734-5440908 Length = 530 Score = 27.5 bits (58), Expect = 8.3 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +2 Query: 341 FNLDCSQRPKLQTPQPSLHCIRQNGYFSHEDPKECGK 451 F + C RP + +P + C+ F H D +C K Sbjct: 287 FAIKCDNRPYKRGNKPDIRCLLCQKLFLHADITQCMK 323 >01_06_1397 - 37017468-37017561,37017763-37017836,37019128-37019193, 37019543-37019623,37019735-37019943,37020096-37020192, 37020497-37020514,37020597-37020727,37021040-37021088, 37021450-37021539,37021616-37021721,37021815-37021885, 37021963-37022037,37022059-37022120,37022677-37022887, 37023599-37024069,37024387-37024719 Length = 745 Score = 27.5 bits (58), Expect = 8.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 338 PFNLDCSQRPKLQTPQPSLH 397 PF++ C + KL P PSLH Sbjct: 81 PFSVRCKLQAKLMPPHPSLH 100 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,227,388 Number of Sequences: 37544 Number of extensions: 346225 Number of successful extensions: 812 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1376330256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -