BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0579 (585 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.55 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 2.9 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 5.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 6.7 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 6.7 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.0 bits (52), Expect = 0.55 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 428 EDPKECGKFYFCVDGK 475 ED K K YFC+DGK Sbjct: 419 EDWKPLDKCYFCLDGK 434 Score = 22.2 bits (45), Expect = 3.9 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 356 SQRPKLQTPQPSLHCIRQNGYFSHEDPKECG 448 SQ+P+ Q PQP +Q + KE G Sbjct: 1521 SQQPQQQQPQPQQQQQQQQQQQPQQQQKEYG 1551 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 422 RSSHFDEYSGGKVEVFEAWVSE 357 +SS FD + +V+ +E WV + Sbjct: 98 KSSEFDSINSIRVKSYEIWVPD 119 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 5.1 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 419 SSHFDEYSGGKVEV 378 S HF EY G +E+ Sbjct: 335 SEHFFEYGGNNIEI 348 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 286 WAKFLNYITTPAFIIFVTLFGVSK 215 W K ITTPA + V F + K Sbjct: 490 WWKICWTITTPAICVGVFTFNIIK 513 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 286 WAKFLNYITTPAFIIFVTLFGVSK 215 W K ITTPA + V F + K Sbjct: 543 WWKICWTITTPAICVGVFTFNIIK 566 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,039 Number of Sequences: 438 Number of extensions: 3692 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -