BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0578 (824 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 22 7.9 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 7.9 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 7.9 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 21.8 bits (44), Expect = 7.9 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = -2 Query: 565 ITFLDQKAKIDIQPVAKSPMELKLQSVTLTHYSSGELS 452 I F +++AKI K+P+ L+L + L ++S+ L+ Sbjct: 66 IWFQNKRAKIKKASGQKNPLALQLMAQGLYNHSTVPLT 103 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.8 bits (44), Expect = 7.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 200 CAMPHCNISAIFMAPYIIFNLTK 132 C + H + I++ P +FNLTK Sbjct: 217 CDILHLRHTKIWLRPDWLFNLTK 239 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 7.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 Query: 381 HRAQPHTMLASSLSLCEDH 325 H A H +L S LCE H Sbjct: 282 HHANHHAILGHSGFLCERH 300 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,056 Number of Sequences: 438 Number of extensions: 4335 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26338809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -