Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0570
         (383 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase p...    23   1.2  
AY343324-1|AAQ21381.1|  156|Apis mellifera vacuolar H+ ATP synth...    21   3.7  

>EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase
           protein.
          Length = 620

 Score = 23.0 bits (47), Expect = 1.2
 Identities = 13/50 (26%), Positives = 23/50 (46%)
 Frame = -2

Query: 349 PVHAPFYTILLEINNIREGGRSQNLILFIRGNAISGAPSIRGTNQFPNPP 200
           P HAP +TI ++I+     G+ +   +       +   ++R   QF N P
Sbjct: 58  PTHAPIFTIAVQIDGQTYEGKGRTKKM---AKHAAAELALRNIVQFRNTP 104


>AY343324-1|AAQ21381.1|  156|Apis mellifera vacuolar H+ ATP synthase
           16 kDa proteolipidsubunit protein.
          Length = 156

 Score = 21.4 bits (43), Expect = 3.7
 Identities = 5/11 (45%), Positives = 10/11 (90%)
 Frame = -2

Query: 352 HPVHAPFYTIL 320
           HP++APF+ ++
Sbjct: 6   HPIYAPFFGVM 16


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 91,749
Number of Sequences: 438
Number of extensions: 1795
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  9424380
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)