BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0570 (383 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 1.2 AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synth... 21 3.7 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.0 bits (47), Expect = 1.2 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = -2 Query: 349 PVHAPFYTILLEINNIREGGRSQNLILFIRGNAISGAPSIRGTNQFPNPP 200 P HAP +TI ++I+ G+ + + + ++R QF N P Sbjct: 58 PTHAPIFTIAVQIDGQTYEGKGRTKKM---AKHAAAELALRNIVQFRNTP 104 >AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synthase 16 kDa proteolipidsubunit protein. Length = 156 Score = 21.4 bits (43), Expect = 3.7 Identities = 5/11 (45%), Positives = 10/11 (90%) Frame = -2 Query: 352 HPVHAPFYTIL 320 HP++APF+ ++ Sbjct: 6 HPIYAPFFGVM 16 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,749 Number of Sequences: 438 Number of extensions: 1795 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9424380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -