BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0548 (372 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40014| Best HMM Match : Chromo (HMM E-Value=0.73) 29 0.91 SB_1276| Best HMM Match : MOZ_SAS (HMM E-Value=0) 29 0.91 SB_22117| Best HMM Match : p450 (HMM E-Value=1.1e-09) 28 2.8 >SB_40014| Best HMM Match : Chromo (HMM E-Value=0.73) Length = 153 Score = 29.5 bits (63), Expect = 0.91 Identities = 12/34 (35%), Positives = 24/34 (70%), Gaps = 3/34 (8%) Frame = -2 Query: 137 HENNVFSRYLFTH---TSRVMEDNKKFLSSVKSQ 45 +E +++SRY+F + T+R + DNK+ +++ K Q Sbjct: 3 YEISIYSRYIFGYTAPTTRTVADNKRVMAAAKKQ 36 >SB_1276| Best HMM Match : MOZ_SAS (HMM E-Value=0) Length = 475 Score = 29.5 bits (63), Expect = 0.91 Identities = 12/34 (35%), Positives = 24/34 (70%), Gaps = 3/34 (8%) Frame = -2 Query: 137 HENNVFSRYLFTH---TSRVMEDNKKFLSSVKSQ 45 +E +++SRY+F + T+R + DNK+ +++ K Q Sbjct: 3 YEISIYSRYIFGYTAPTTRTVADNKRVMAAAKKQ 36 >SB_22117| Best HMM Match : p450 (HMM E-Value=1.1e-09) Length = 307 Score = 27.9 bits (59), Expect = 2.8 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = -2 Query: 125 VFSRYLFTHTSRVMEDNKKFLSSVKSQQ 42 +FSR F+HT ++E +K +++ K+Q+ Sbjct: 118 MFSRVFFSHTKELVEMTEKVIAAKKTQE 145 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,734,055 Number of Sequences: 59808 Number of extensions: 137874 Number of successful extensions: 112 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 607387585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -