BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0536 (324 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6LFY3 Cluster: Putative integrase/transposase; n=1; Pa... 33 1.2 UniRef50_Q54LW7 Cluster: Putative uncharacterized protein; n=1; ... 31 6.5 UniRef50_Q70H59 Cluster: Virion core membrane protein E8R orthol... 30 8.6 UniRef50_Q05FK7 Cluster: Putative uncharacterized protein; n=1; ... 30 8.6 UniRef50_A2EYE0 Cluster: Putative uncharacterized protein; n=1; ... 30 8.6 >UniRef50_A6LFY3 Cluster: Putative integrase/transposase; n=1; Parabacteroides distasonis ATCC 8503|Rep: Putative integrase/transposase - Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC11152) Length = 319 Score = 33.1 bits (72), Expect = 1.2 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -2 Query: 254 LNRGLVNDFITFLITKNVIFNKVHTYLIS 168 LNR LV DFIT+L K + N V+TY+ S Sbjct: 57 LNRALVIDFITYLQGKGLATNTVNTYISS 85 >UniRef50_Q54LW7 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 76 Score = 30.7 bits (66), Expect = 6.5 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 1 FFFFFFDGSNYLFIIINNLVHMVF 72 F+F+F+ NY F + +VH++F Sbjct: 14 FYFYFYFFCNYFFFLFKQIVHLIF 37 >UniRef50_Q70H59 Cluster: Virion core membrane protein E8R orthologue; n=3; Avipoxvirus|Rep: Virion core membrane protein E8R orthologue - Fowlpox virus (isolate HP-438[Munich]) Length = 272 Score = 30.3 bits (65), Expect = 8.6 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +1 Query: 100 N*KYLNY*VIIKLSMFFK*FKYVEIK*VCTLLKITFFVIKNVIKSFTNPLFN 255 N +YLN + L+ +FK F + + + + L +T I N++ F N FN Sbjct: 96 NIQYLNQISTVNLNDYFKKFSILPVDQLISFLLLTSIPIYNILFFFKNTTFN 147 >UniRef50_Q05FK7 Cluster: Putative uncharacterized protein; n=1; Candidatus Carsonella ruddii PV|Rep: Putative uncharacterized protein - Carsonella ruddii (strain PV) Length = 102 Score = 30.3 bits (65), Expect = 8.6 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -2 Query: 257 QLNRGLVNDFITFLITKNVIFNKVHTY 177 ++N L+ D+I F+ KN+IFNK+ + Sbjct: 21 KINNYLIVDYINFIPGKNIIFNKIKLF 47 >UniRef50_A2EYE0 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 788 Score = 30.3 bits (65), Expect = 8.6 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -1 Query: 321 VCIPVYNSRKNDLFICFGQEMT 256 +C+ + NS +NDLF+C G E T Sbjct: 409 LCLRISNSLRNDLFLCSGYEET 430 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 236,722,834 Number of Sequences: 1657284 Number of extensions: 3461469 Number of successful extensions: 5787 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5781 length of database: 575,637,011 effective HSP length: 84 effective length of database: 436,425,155 effective search space used: 10037778565 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -