BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0531 (301 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69635-3|CAA93460.1| 342|Caenorhabditis elegans Hypothetical pr... 36 0.005 Z69635-4|CAB54216.1| 336|Caenorhabditis elegans Hypothetical pr... 34 0.016 >Z69635-3|CAA93460.1| 342|Caenorhabditis elegans Hypothetical protein F19B6.2a protein. Length = 342 Score = 35.9 bits (79), Expect = 0.005 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Frame = +3 Query: 156 FNMTYRCYSFSMLPG---NERQDVERGGKIIMPPSALEQLTRLNIEYPMIF 299 ++ T+ Y LP ++ ++ GGKI++P SAL L + NI PM+F Sbjct: 21 YDQTFVVYGPVFLPNATQSKISEINYGGKILLPSSALNLLMQYNIPMPMLF 71 >Z69635-4|CAB54216.1| 336|Caenorhabditis elegans Hypothetical protein F19B6.2b protein. Length = 336 Score = 34.3 bits (75), Expect = 0.016 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +3 Query: 213 DVERGGKIIMPPSALEQLTRLNIEYPMIF 299 ++ GGKI++P SAL L + NI PM+F Sbjct: 37 EINYGGKILLPSSALNLLMQYNIPMPMLF 65 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,453,879 Number of Sequences: 27780 Number of extensions: 111075 Number of successful extensions: 213 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 213 length of database: 12,740,198 effective HSP length: 70 effective length of database: 10,795,598 effective search space used: 313072342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -