BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0512 (300 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC131897-1|AAI31898.1| 420|Homo sapiens LRRC4B protein protein. 29 3.5 BC065004-1|AAH65004.1| 306|Homo sapiens coiled-coil domain cont... 29 3.5 BC032460-1|AAH32460.1| 634|Homo sapiens LRRC4B protein protein. 29 3.5 BC019687-1|AAH19687.1| 430|Homo sapiens LRRC4B protein protein. 29 3.5 AJ416916-1|CAC95196.1| 306|Homo sapiens C3orf6 protein protein. 29 3.5 >BC131897-1|AAI31898.1| 420|Homo sapiens LRRC4B protein protein. Length = 420 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 194 VHVNEGKLLFRCVILWLSSFFILKLNCPCNMECC 295 VH+N C +LWLS + LK P N CC Sbjct: 306 VHLNHNPWHCNCDVLWLS--WWLKETVPSNTTCC 337 >BC065004-1|AAH65004.1| 306|Homo sapiens coiled-coil domain containing 50 protein. Length = 306 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -1 Query: 258 MKNEESHNITHRKRSFPSFTCTKLHAHSFYIFKAGKLP 145 ++ +E RK+ FP F T+ +A S+Y G P Sbjct: 116 LQEKELQEEKKRKKHFPEFPATRAYADSYYYEDGGMKP 153 >BC032460-1|AAH32460.1| 634|Homo sapiens LRRC4B protein protein. Length = 634 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 194 VHVNEGKLLFRCVILWLSSFFILKLNCPCNMECC 295 VH+N C +LWLS + LK P N CC Sbjct: 306 VHLNHNPWHCNCDVLWLS--WWLKETVPSNTTCC 337 >BC019687-1|AAH19687.1| 430|Homo sapiens LRRC4B protein protein. Length = 430 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 194 VHVNEGKLLFRCVILWLSSFFILKLNCPCNMECC 295 VH+N C +LWLS + LK P N CC Sbjct: 99 VHLNHNPWHCNCDVLWLS--WWLKETVPSNTTCC 130 >AJ416916-1|CAC95196.1| 306|Homo sapiens C3orf6 protein protein. Length = 306 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -1 Query: 258 MKNEESHNITHRKRSFPSFTCTKLHAHSFYIFKAGKLP 145 ++ +E RK+ FP F T+ +A S+Y G P Sbjct: 116 LQEKELQEEKKRKKHFPEFPATRAYADSYYYEDGGMKP 153 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,826,562 Number of Sequences: 237096 Number of extensions: 820889 Number of successful extensions: 888 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 888 length of database: 76,859,062 effective HSP length: 76 effective length of database: 58,839,766 effective search space used: 1353314618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -