SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0510
         (380 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ137801-1|AAZ78362.1|  622|Anopheles gambiae male-specific doub...    25   0.94 
AY825832-1|AAV70395.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825831-1|AAV70394.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825830-1|AAV70393.1|  169|Anopheles gambiae heat shock protein...    23   2.9  
AY825829-1|AAV70392.1|  169|Anopheles gambiae heat shock protein...    23   2.9  
AY825828-1|AAV70391.1|  172|Anopheles gambiae heat shock protein...    23   2.9  
AY825827-1|AAV70390.1|  172|Anopheles gambiae heat shock protein...    23   2.9  
AY825826-1|AAV70389.1|  169|Anopheles gambiae heat shock protein...    23   2.9  
AY825825-1|AAV70388.1|  169|Anopheles gambiae heat shock protein...    23   2.9  
AY825824-1|AAV70387.1|  161|Anopheles gambiae heat shock protein...    23   2.9  
AY825823-1|AAV70386.1|  161|Anopheles gambiae heat shock protein...    23   2.9  
AY825822-1|AAV70385.1|  159|Anopheles gambiae heat shock protein...    23   2.9  
AY825821-1|AAV70384.1|  159|Anopheles gambiae heat shock protein...    23   2.9  
AY825820-1|AAV70383.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825819-1|AAV70382.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825818-1|AAV70381.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825817-1|AAV70380.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825816-1|AAV70379.1|  162|Anopheles gambiae heat shock protein...    23   2.9  
AY825815-1|AAV70378.1|  162|Anopheles gambiae heat shock protein...    23   2.9  
AY825814-1|AAV70377.1|  169|Anopheles gambiae heat shock protein...    23   2.9  
AY825813-1|AAV70376.1|  169|Anopheles gambiae heat shock protein...    23   2.9  
AY825812-1|AAV70375.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825811-1|AAV70374.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825810-1|AAV70373.1|  169|Anopheles gambiae heat shock protein...    23   2.9  
AY825809-1|AAV70372.1|  169|Anopheles gambiae heat shock protein...    23   2.9  
AY825808-1|AAV70371.1|  171|Anopheles gambiae heat shock protein...    23   2.9  
AY825807-1|AAV70370.1|  171|Anopheles gambiae heat shock protein...    23   2.9  
AY825806-1|AAV70369.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825805-1|AAV70368.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825804-1|AAV70367.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825803-1|AAV70366.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825802-1|AAV70365.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825801-1|AAV70364.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825800-1|AAV70363.1|  171|Anopheles gambiae heat shock protein...    23   2.9  
AY825799-1|AAV70362.1|  171|Anopheles gambiae heat shock protein...    23   2.9  
AY825798-1|AAV70361.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825797-1|AAV70360.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825796-1|AAV70359.1|  174|Anopheles gambiae heat shock protein...    23   2.9  
AY825795-1|AAV70358.1|  174|Anopheles gambiae heat shock protein...    23   2.9  
AY825794-1|AAV70357.1|  169|Anopheles gambiae heat shock protein...    23   2.9  
AY825793-1|AAV70356.1|  169|Anopheles gambiae heat shock protein...    23   2.9  
AY825792-1|AAV70355.1|  153|Anopheles gambiae heat shock protein...    23   2.9  
AY825791-1|AAV70354.1|  153|Anopheles gambiae heat shock protein...    23   2.9  
AY825790-1|AAV70353.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825789-1|AAV70352.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825788-1|AAV70351.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825787-1|AAV70350.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825786-1|AAV70349.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825785-1|AAV70348.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825784-1|AAV70347.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825783-1|AAV70346.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825782-1|AAV70345.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
AY825781-1|AAV70344.1|  168|Anopheles gambiae heat shock protein...    23   2.9  
CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel...    23   5.0  
EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc...    22   8.7  

>DQ137801-1|AAZ78362.1|  622|Anopheles gambiae male-specific
           doublesex protein protein.
          Length = 622

 Score = 25.0 bits (52), Expect = 0.94
 Identities = 10/30 (33%), Positives = 19/30 (63%)
 Frame = -1

Query: 281 KHNKVSIHFFDLEFEITGIVLVNRTLFRSY 192
           K+N++  + F L   + G+  VNRTL+ ++
Sbjct: 491 KYNELEANNFPLPLLLPGLEAVNRTLYTAH 520


>AY825832-1|AAV70395.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825831-1|AAV70394.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825830-1|AAV70393.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 96  IMFYADWCFAC 106


>AY825829-1|AAV70392.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 96  IMFYADWCFAC 106


>AY825828-1|AAV70391.1|  172|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 172

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 96  IMFYADWCFAC 106


>AY825827-1|AAV70390.1|  172|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 172

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 96  IMFYADWCFAC 106


>AY825826-1|AAV70389.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 96  IMFYADWCFAC 106


>AY825825-1|AAV70388.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 96  IMFYADWCFAC 106


>AY825824-1|AAV70387.1|  161|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 161

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 81  IMFYADWCFAC 91


>AY825823-1|AAV70386.1|  161|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 161

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 81  IMFYADWCFAC 91


>AY825822-1|AAV70385.1|  159|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 159

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 83  IMFYADWCFAC 93


>AY825821-1|AAV70384.1|  159|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 159

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 83  IMFYADWCFAC 93


>AY825820-1|AAV70383.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825819-1|AAV70382.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825818-1|AAV70381.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825817-1|AAV70380.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825816-1|AAV70379.1|  162|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 162

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 86  IMFYADWCFAC 96


>AY825815-1|AAV70378.1|  162|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 162

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 86  IMFYADWCFAC 96


>AY825814-1|AAV70377.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 96  IMFYADWCFAC 106


>AY825813-1|AAV70376.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 96  IMFYADWCFAC 106


>AY825812-1|AAV70375.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825811-1|AAV70374.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825810-1|AAV70373.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 96  IMFYADWCFAC 106


>AY825809-1|AAV70372.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 96  IMFYADWCFAC 106


>AY825808-1|AAV70371.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825807-1|AAV70370.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825806-1|AAV70369.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825805-1|AAV70368.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825804-1|AAV70367.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825803-1|AAV70366.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825802-1|AAV70365.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825801-1|AAV70364.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825800-1|AAV70363.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 96  IMFYADWCFAC 106


>AY825799-1|AAV70362.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 96  IMFYADWCFAC 106


>AY825798-1|AAV70361.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825797-1|AAV70360.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825796-1|AAV70359.1|  174|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 174

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 98  IMFYADWCFAC 108


>AY825795-1|AAV70358.1|  174|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 174

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 98  IMFYADWCFAC 108


>AY825794-1|AAV70357.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825793-1|AAV70356.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825792-1|AAV70355.1|  153|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 153

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 80  IMFYADWCFAC 90


>AY825791-1|AAV70354.1|  153|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 153

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 80  IMFYADWCFAC 90


>AY825790-1|AAV70353.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825789-1|AAV70352.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825788-1|AAV70351.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825787-1|AAV70350.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825786-1|AAV70349.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825785-1|AAV70348.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825784-1|AAV70347.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825783-1|AAV70346.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825782-1|AAV70345.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>AY825781-1|AAV70344.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 273 IMFYSPWCXHC 305
           IMFY+ WC  C
Sbjct: 95  IMFYADWCFAC 105


>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative
           cytoskeletal structural protein protein.
          Length = 1645

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = -1

Query: 128 TMPL*IEVTFLGCFHLYLFSFS 63
           ++PL I   F+   H  LFSFS
Sbjct: 48  SVPLFINFIFMFLLHFVLFSFS 69


>EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium
           channel alpha1 subunit protein.
          Length = 1893

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 7/28 (25%), Positives = 16/28 (57%)
 Frame = +2

Query: 254 RNGWKLYYVLLAMVXTLHIILSDMVRIG 337
           RNGW +    + ++  +   LS++++ G
Sbjct: 181 RNGWNILDFTIVVIGMISTALSNLMKEG 208


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 370,614
Number of Sequences: 2352
Number of extensions: 6887
Number of successful extensions: 58
Number of sequences better than 10.0: 55
Number of HSP's better than 10.0 without gapping: 58
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 58
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 29074284
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -