BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0480 (514 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0594 + 25349612-25352530 28 3.8 11_06_0567 - 25038537-25038957,25039059-25039252 28 5.1 01_06_0495 - 29779499-29781325 28 5.1 11_06_0667 + 26071774-26072070,26072352-26073153,26073209-260734... 27 8.8 04_04_0415 + 25038826-25038835,25039333-25039964,25040484-250405... 27 8.8 03_06_0642 + 35239658-35240083,35240167-35240238,35240305-352409... 27 8.8 >11_06_0594 + 25349612-25352530 Length = 972 Score = 28.3 bits (60), Expect = 3.8 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = -1 Query: 268 AICFCLSVHFAQWVSKASGILSLIF 194 ++CFC +H + W+S A +L+ + Sbjct: 426 SLCFCSPLHLSSWLSNAEKMLTFCY 450 >11_06_0567 - 25038537-25038957,25039059-25039252 Length = 204 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 283 CASCFAICFCLSVHFAQWVSKASGILSLI 197 C + A FC VH A +VS A+G+ L+ Sbjct: 135 CTTAAAGNFCNQVHIAMYVSLAAGVALLV 163 >01_06_0495 - 29779499-29781325 Length = 608 Score = 27.9 bits (59), Expect = 5.1 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +3 Query: 198 IKDKIP-EALETHCAKCTDKQKQMAKQLAQGIKKTHPELWDEFITFYDPQGKYQTSFKDF 374 +KD IP L T +K D K A++L G+ + W+ I Y G+YQ + + F Sbjct: 148 VKDPIPMNCLITGYSKSGDVVK--ARRLFDGMVRRTSASWNSMIACYAHGGEYQEALRLF 205 >11_06_0667 + 26071774-26072070,26072352-26073153,26073209-26073411, 26075078-26075521,26075703-26075758,26076323-26076402, 26077098-26077174,26077279-26078301 Length = 993 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +3 Query: 231 HCAKCTDKQKQMAKQLAQGIKKTHPELWDEFITFYDPQGKYQTSFKDF 374 H + +D ++ KQ + + +D F+T YD YQ S ++F Sbjct: 146 HMGRLSDGREVAIKQFHDDLS-IYASKYDPFVTHYDHDEFYQRSIEEF 192 >04_04_0415 + 25038826-25038835,25039333-25039964,25040484-25040561, 25040588-25040833,25041598-25041684,25041860-25042024 Length = 405 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 293 EDTPGVMGRVHYFLRPSR 346 ED G+ + HYF+RPSR Sbjct: 158 EDVLGLFRKFHYFVRPSR 175 >03_06_0642 + 35239658-35240083,35240167-35240238,35240305-35240919, 35241253-35241435,35241604-35241663,35241733-35241936, 35242497-35242745,35243609-35243707,35243760-35243858, 35244463-35244480,35244668-35244862,35244981-35245073, 35245265-35245531,35245884-35246102 Length = 932 Score = 27.1 bits (57), Expect = 8.8 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = -1 Query: 118 TSEASKLSSIGSYLS*ASTAKNRPRKTNSSFILKFSTRF 2 T + +SSI SY S ST++NR K N S +L ST + Sbjct: 181 TESSMDMSSILSYQSNNSTSQNRGLK-NFSLLLSLSTLY 218 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,332,341 Number of Sequences: 37544 Number of extensions: 202615 Number of successful extensions: 510 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1106928780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -