BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0475 (827 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 23 2.2 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 23 2.2 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 23.4 bits (48), Expect = 2.2 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -3 Query: 549 DQFINQEIEMCATILRCKQTYSISMRARALLTLLTKWRRER 427 + F N+ +E C + K IS RAL L T+ R + Sbjct: 59 EDFDNRLVEYCTQDFKKKHKADISGNPRALRRLRTQCERAK 99 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 23.4 bits (48), Expect = 2.2 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -3 Query: 549 DQFINQEIEMCATILRCKQTYSISMRARALLTLLTKWRRER 427 + F N+ +E C + K IS RAL L T+ R + Sbjct: 59 EDFDNRLVEYCTQDFKKKHKADISGNPRALRRLRTQCERAK 99 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,048 Number of Sequences: 336 Number of extensions: 3633 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22725411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -