BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0473 (790 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0453 - 34031862-34032668 30 2.4 11_04_0364 - 16791774-16792490,16792545-16793561,16793856-167939... 29 5.6 11_04_0457 + 17916177-17916526,17917397-17917523,17917887-179182... 28 7.4 >03_06_0453 - 34031862-34032668 Length = 268 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 507 PTIIDEAEVRWVIERPPIFLNSLHCKSDKEIEGGELRWVK 626 P + + VR ++ PP+ L+SL I GGELRWV+ Sbjct: 71 PVLTVQESVRATLDSPPL-LSSLLPHRANLIGGGELRWVQ 109 >11_04_0364 - 16791774-16792490,16792545-16793561,16793856-16793920, 16794787-16796964,16797065-16797322,16799815-16800172 Length = 1530 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +3 Query: 591 KEIEGGELRWVKMTNNSSLPMDAIVGGYENEPLYIARAIHFNSLTPGKYLRTTNKMFVPW 770 K++ EL ++ N LP ++ Y+N P+Y+ R SL P Y+ N++ W Sbjct: 361 KDVIESELWDLEQPRNEVLP--SLELSYKNMPIYLKRCFVAISLYPKDYIFDRNQVLQLW 418 >11_04_0457 + 17916177-17916526,17917397-17917523,17917887-17918287, 17918496-17918704,17919328-17919449,17920437-17920562, 17920675-17920801,17920945-17921000 Length = 505 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +3 Query: 129 EIMGDIVELNSTEGQVLYRANSSAIRIRVSFPLSAEPHITFYSKFPPHQELYQLYIGEV 305 +I+ + +N Q ++ SAI FPL H Y K P + Y++++G++ Sbjct: 294 DIVSSVHYVNERYPQAGTSSSGSAIPPLTMFPLELASHKILYEKIPTGE--YKIFLGDI 350 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,041,285 Number of Sequences: 37544 Number of extensions: 439101 Number of successful extensions: 899 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 871 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 899 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2127163404 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -