BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0473 (790 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g17710.1 68416.m02260 F-box family protein contains F-box dom... 33 0.16 At5g61340.1 68418.m07697 expressed protein 31 0.87 At5g53510.1 68418.m06650 oligopeptide transporter OPT family pro... 28 8.1 At3g51420.1 68416.m05632 strictosidine synthase family protein s... 28 8.1 >At3g17710.1 68416.m02260 F-box family protein contains F-box domain Pfam:PF00646 Length = 368 Score = 33.5 bits (73), Expect = 0.16 Identities = 24/92 (26%), Positives = 31/92 (33%) Frame = -3 Query: 560 YWGSFNHPSNLSFIYYCRDMKTYKTNFFCILKFYTSHGFNVRTQTILKFSTVPRYPKIFE 381 YW + NHP L + D FC+L G N + K + FE Sbjct: 205 YWLAHNHPETLEYFIETFDFSMEIFKPFCLLPCRKDFGSNELVLAVFKEDRFSLLKQCFE 264 Query: 380 LDKRSWWVFVVIINNITL*YVYKFKYLPNIQL 285 K WV + I+ KF LP L Sbjct: 265 TTKIEIWVTKMKIDREEEVVWIKFMTLPTTNL 296 >At5g61340.1 68418.m07697 expressed protein Length = 326 Score = 31.1 bits (67), Expect = 0.87 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 551 SFNHPSNLSFIYYCRDMKTYKTNFFCIL 468 S NH ++ S ++Y R +KTY NFF +L Sbjct: 111 SNNHSADSSSVFYLRLLKTYVCNFFFLL 138 >At5g53510.1 68418.m06650 oligopeptide transporter OPT family protein similar to SP|P40900 Sexual differentiation process protein isp4 {Schizosaccharomyces pombe}, oligopeptide transporter Opt1p [Candida albicans] GI:2367386; contains Pfam profile PF03169: OPT oligopeptide transporter protein Length = 741 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 365 WWVFVVIINNITL*YVYKFKYLPNIQL 285 WW +V+++ NI L F Y +QL Sbjct: 420 WWFYVILVLNIALIMFISFYYNATVQL 446 >At3g51420.1 68416.m05632 strictosidine synthase family protein similar to hemomucin [Drosophila melanogaster][GI:1280434], strictosidine synthase [Rauvolfia serpentina][SP|P15324]; contains strictosidine synthase domain PF03088 Length = 370 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 779 SMSPRHKHFVCCSKVFSRCQR 717 SMSP HFV C + RC + Sbjct: 222 SMSPDQTHFVFCETIMRRCSK 242 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,624,295 Number of Sequences: 28952 Number of extensions: 383197 Number of successful extensions: 815 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 815 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1775300800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -