BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0472 (834 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 6.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 6.1 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 8.0 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 8.0 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 3.5 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = +2 Query: 731 LVYDLSSVSEWVPERTYYRVMPSSTPKSRC 820 ++ + S S W P R Y + P RC Sbjct: 1672 VIRSIRSHSTWDPRRHMYEELNHCAPNRRC 1701 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 6.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 774 RSGTHSETDERSYTKMTQDEVDLRRQSVHARIGVIL 667 +SG + E ER+YTK+ + L + R G L Sbjct: 750 KSGEYEELRERAYTKILSNGTLLLQHVKEDREGFYL 785 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 6.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 774 RSGTHSETDERSYTKMTQDEVDLRRQSVHARIGVIL 667 +SG + E ER+YTK+ + L + R G L Sbjct: 746 KSGEYEELRERAYTKILSNGTLLLQHVKEDREGFYL 781 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 8.0 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -1 Query: 360 HVEESNVFVHGCRHFLFIYLISF 292 +++ S ++ GC FLF ++ F Sbjct: 290 YIKASEIWFLGCTIFLFAAMVEF 312 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 8.0 Identities = 10/40 (25%), Positives = 23/40 (57%) Frame = +1 Query: 85 KTKRNNIVTQVNCNHRQ*YYEYNNGKIGNEY*GVPLTIIS 204 K + +I T ++C+ + YYE ++ ++ G P +++S Sbjct: 953 KAVKKHITTTIDCSTQSEYYEL---EVKDQKNGKPPSVVS 989 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 236,284 Number of Sequences: 438 Number of extensions: 5384 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -