BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0465 (791 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40590.1 68418.m04926 DC1 domain-containing protein predicted... 29 3.5 At3g02110.1 68416.m00177 serine carboxypeptidase S10 family prot... 28 6.2 >At5g40590.1 68418.m04926 DC1 domain-containing protein predicted protein, Arabidopsis thaliana Length = 234 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 614 THQLHYKIKIIKSNRSFSCNTANSYGIKFEYN 519 +HQ H I +++CN YG F YN Sbjct: 68 SHQPHTLTLIYSPKSTYTCNACGEYGSSFTYN 99 >At3g02110.1 68416.m00177 serine carboxypeptidase S10 family protein similar to serine carboxypeptidase II (CP-MII) GB:CAA70815 (SP:P08818) [Hordeum vulgare] Length = 473 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -1 Query: 641 SHSVILFKNTHQLHYKIKIIKSNRSFSCNTANSYGIKFEYNSTNNY 504 SH++I + HQL + S C T SY ++ E+ + + Y Sbjct: 236 SHAMISDRTYHQLISTCDFSRQKESDECETLYSYAMEQEFGNIDQY 281 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,289,705 Number of Sequences: 28952 Number of extensions: 261384 Number of successful extensions: 444 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 444 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1785055200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -