SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0463
         (762 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC139.05 |||succinate-semialdehyde dehydrogenase |Schizosaccha...    27   3.9  

>SPAC139.05 |||succinate-semialdehyde dehydrogenase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 493

 Score = 26.6 bits (56), Expect = 3.9
 Identities = 13/39 (33%), Positives = 21/39 (53%)
 Frame = -2

Query: 485 YEMKYNLSKMVIIY*DFFSGLIGGS*EVMSSGFVSFSHI 369
           Y    NLS M+ +  +   GL+G + E++   F+SF  I
Sbjct: 427 YVFTNNLSTMIHVAKELEVGLVGANIEMVDEPFISFGGI 465


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,805,671
Number of Sequences: 5004
Number of extensions: 53855
Number of successful extensions: 90
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 89
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 90
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 365309308
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -