BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0463 (762 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0511 + 4459685-4459755,4461553-4463653,4463741-4463808,446... 29 5.3 06_01_0946 + 7289182-7289226,7291366-7291441,7291542-7291655,729... 29 5.3 >08_01_0511 + 4459685-4459755,4461553-4463653,4463741-4463808, 4465156-4465282,4465379-4465429 Length = 805 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 594 CLILMYIHIFMKSDIME*NEMKMINLRHLRMKLN 493 CL ++HI M ++E E M L+HL +K N Sbjct: 570 CLKYFFLHINMCGTLLEFEEGSMPKLQHLMIKFN 603 >06_01_0946 + 7289182-7289226,7291366-7291441,7291542-7291655, 7291881-7292447,7293047-7293792 Length = 515 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = -2 Query: 362 LSQILNS*QTTIITHLNPKKH*IDKIKQITQLHSSFPPKS 243 +++IL++ Q++I H N KH +K IT + + F P S Sbjct: 305 ITRILSARQSSIFLHRNNSKHIPFSMKNITDILTMFSPVS 344 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,422,807 Number of Sequences: 37544 Number of extensions: 291374 Number of successful extensions: 464 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 464 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2039640244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -