BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0463 (762 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132877-14|CAD92388.1| 439|Caenorhabditis elegans Hypothetical... 30 2.1 AL132877-13|CAC70110.4| 478|Caenorhabditis elegans Hypothetical... 30 2.1 U40410-1|AAA81391.1| 480|Caenorhabditis elegans Hypothetical pr... 29 2.7 >AL132877-14|CAD92388.1| 439|Caenorhabditis elegans Hypothetical protein Y105E8B.8b protein. Length = 439 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +3 Query: 210 RNKEHNKSPYGTFW-WEGGVKLCDLFYFVYLVFLR 311 RN E +GT W WEG +L ++ YF+YL+ LR Sbjct: 236 RNTEMFAGRFGTKWSWEGPQRLRNV-YFIYLLELR 269 >AL132877-13|CAC70110.4| 478|Caenorhabditis elegans Hypothetical protein Y105E8B.8a protein. Length = 478 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +3 Query: 210 RNKEHNKSPYGTFW-WEGGVKLCDLFYFVYLVFLR 311 RN E +GT W WEG +L ++ YF+YL+ LR Sbjct: 275 RNTEMFAGRFGTKWSWEGPQRLRNV-YFIYLLELR 308 >U40410-1|AAA81391.1| 480|Caenorhabditis elegans Hypothetical protein C54G7.2 protein. Length = 480 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 444 LRFFQWTYWWILRSYVQRLCFIF 376 L FFQW +WW + + R + F Sbjct: 256 LPFFQWFFWWFITIFFIRCAYYF 278 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,247,187 Number of Sequences: 27780 Number of extensions: 292680 Number of successful extensions: 564 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1819579054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -