BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
Query= an--0462
         (749 letters)
Database: rice 
           37,544 sequences; 14,793,348 total letters
Searching..................................................done
                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value
01_07_0286 - 42519269-42519754,42524657-42525253,42525277-42526311     30   2.3  
>01_07_0286 - 42519269-42519754,42524657-42525253,42525277-42526311
          Length = 705
 Score = 29.9 bits (64), Expect = 2.3
 Identities = 18/63 (28%), Positives = 28/63 (44%)
 Frame = +2
Query: 245 ECRLNEIAPSMCVFDTIKSSSDRDRDTFLPLRDYWWPGGLSSFTRTGGRAKAQPGGVGFA 424
           +C+   ++   CV   + ++        LPLR     GG + F +TGG A    GG G  
Sbjct: 365 DCQAACMSDCFCVAALLDTNDGTCTKQQLPLRYGRAGGGYTMFVKTGGAASPALGGGGGG 424
Query: 425 NSY 433
           N +
Sbjct: 425 NHH 427
  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.279   0.0580    0.190 
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,744,240
Number of Sequences: 37544
Number of extensions: 279155
Number of successful extensions: 649
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 640
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 649
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1992480932
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -