BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0460 (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31213| Best HMM Match : SNF2_N (HMM E-Value=0) 32 0.40 SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) 30 1.6 SB_16656| Best HMM Match : Methyltransf_3 (HMM E-Value=1.2e-19) 29 3.7 SB_42829| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=8.2) 29 3.7 SB_49989| Best HMM Match : GRP (HMM E-Value=2.3) 29 4.9 SB_30516| Best HMM Match : GETHR (HMM E-Value=0.9) 28 6.5 SB_58579| Best HMM Match : DMP1 (HMM E-Value=2.3) 28 8.6 SB_39486| Best HMM Match : PsiF_repeat (HMM E-Value=5.9) 28 8.6 SB_30| Best HMM Match : DNA_pol_delta_4 (HMM E-Value=2.2) 28 8.6 SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_31213| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 919 Score = 32.3 bits (70), Expect = 0.40 Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Frame = -1 Query: 431 HDGHQRCSLLYVRNHQAQRGSSYHVRHHHRGSR-AGSCGH---QCEGQPRSKHS 282 H GH + HQ + +H HHHR + S GH + G+ S HS Sbjct: 416 HHGHGGLEAIQTSKHQQDQHHHHHHHHHHRHHKHRSSSGHSTTEASGRRASDHS 469 >SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) Length = 2157 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 161 VRHNEQGRNEPRHSVPGHHDGRCSGTKLPQRGGMAED 51 +RH GR R VP HH GR P MA D Sbjct: 1625 LRHLRHGRARHRLKVPAHHRGRHRKKATPSSTDMARD 1661 >SB_16656| Best HMM Match : Methyltransf_3 (HMM E-Value=1.2e-19) Length = 613 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 320 GHQCEGQPRSKHSRIWGEHRCRGH 249 G EG RS++ +W H+CR H Sbjct: 152 GKALEGYVRSEYGNLWETHQCRPH 175 >SB_42829| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=8.2) Length = 127 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -2 Query: 163 GCGIMSRGVMSRGIVCRGIMTDDALGRNCRSVVVWQKTSVGGGQHG 26 G G+M VM G++ G+M D +G V +GGG G Sbjct: 57 GGGVMGGSVMGDGVIGGGVMDDSVMGGGVIGGSVMGDGVMGGGVMG 102 >SB_49989| Best HMM Match : GRP (HMM E-Value=2.3) Length = 181 Score = 28.7 bits (61), Expect = 4.9 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = -1 Query: 386 QAQRGSSYHVRHHHRGSRAGSCGHQCEGQPRSKHSRIWGEHRCRGHERSQEK 231 Q RGS + HHRGS H+ GQ + +H R G+ + E Q K Sbjct: 102 QHHRGSG-QAKQHHRGSGQAKQHHRGSGQAK-QHHRGSGQAKQHHRESGQAK 151 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = -1 Query: 386 QAQRGSSYHVRHHHRGSRAGSCGHQCEGQPRSKHSRIWGEHRCRGHER 243 Q RGS + HHRGS H+ GQ + H G + + H R Sbjct: 82 QHHRGSG-QAKQHHRGSGQAKQHHRGSGQAKQHHR---GSGQAKQHHR 125 >SB_30516| Best HMM Match : GETHR (HMM E-Value=0.9) Length = 1058 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -1 Query: 383 AQRGSSYHVRHHHRGSRAGSCGHQCEGQPRSKHSRIW 273 A G+S+HV H S H Q ++H R+W Sbjct: 360 ASHGTSWHVMARHGTSWQVMASHGTSWQVMARHGRLW 396 >SB_58579| Best HMM Match : DMP1 (HMM E-Value=2.3) Length = 682 Score = 27.9 bits (59), Expect = 8.6 Identities = 17/59 (28%), Positives = 29/59 (49%) Frame = -1 Query: 710 SAADIYLH*VLVSSSLFTHK*HIHQSSVTIISNINRC*LFSNDGDHGVHGPRKHSRRER 534 S D YL+ +++ +K I ++ T S+ +C + DG +G HG R+ R R Sbjct: 588 SNEDYYLN---SDENIYVNKEIIDENDFTESSDNLKCQSYEKDGANGYHGNREDLNRNR 643 >SB_39486| Best HMM Match : PsiF_repeat (HMM E-Value=5.9) Length = 91 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 356 RHHHRGSRAGSCGHQCEGQPRSKHSRIWGEH 264 RHHHR S + G +PR K S G++ Sbjct: 42 RHHHRSSSVPAHGRPQSTEPRLKQSTATGQN 72 >SB_30| Best HMM Match : DNA_pol_delta_4 (HMM E-Value=2.2) Length = 269 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 356 RHHHRGSRAGSCGHQCEGQPRSKHSRIWGEH 264 RHHHR S + G +PR K S G++ Sbjct: 42 RHHHRSSSVPAHGRPQSTEPRLKQSTATGQN 72 >SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1913 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 281 DYAYSVADPHTGDHKSQHESRDGGAVHG 364 D+AY DPHT HK H R G + G Sbjct: 1425 DFAYVARDPHTSKHKC-HMFRCHGNISG 1451 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,738,771 Number of Sequences: 59808 Number of extensions: 355417 Number of successful extensions: 1265 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1246 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -