BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0457 (547 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-1448|AAM68666.1| 1740|Drosophila melanogaster CG8487-PA... 28 9.5 AE013599-1447|AAF58532.2| 1983|Drosophila melanogaster CG8487-PB... 28 9.5 >AE013599-1448|AAM68666.1| 1740|Drosophila melanogaster CG8487-PA, isoform A protein. Length = 1740 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 176 NSEHRIYGKETYGIKFFL*NLKFCVILCNP 87 +++H + YG+ F +F +ILCNP Sbjct: 352 STDHDVTSLSPYGLPFIQELFRFLIILCNP 381 >AE013599-1447|AAF58532.2| 1983|Drosophila melanogaster CG8487-PB, isoform B protein. Length = 1983 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 176 NSEHRIYGKETYGIKFFL*NLKFCVILCNP 87 +++H + YG+ F +F +ILCNP Sbjct: 352 STDHDVTSLSPYGLPFIQELFRFLIILCNP 381 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,711,980 Number of Sequences: 53049 Number of extensions: 307677 Number of successful extensions: 523 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 523 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2069139900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -