BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0456 (539 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 2.0 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 4.6 AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 21 6.1 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 6.1 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.1 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 8.1 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.0 bits (47), Expect = 2.0 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +1 Query: 58 VRRAAAYKLGEFAKVVEIEYVKSDLIPIFVFLAKDDQDSVRLLAAEACAVVASLL 222 VR GE+ VV Y K+ ++ +DD VR++A AVV L+ Sbjct: 495 VRAKTTRGWGEYTPVV---YKKTPHAMGLDYVGEDDNMQVRIIAGAIVAVVVLLV 546 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.8 bits (44), Expect = 4.6 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = -2 Query: 361 LYELALDQQLVAALRTYQRPCTAPSTKYLRHEPARSASHV 242 LYELAL+Q + LR + K L+++ + ++ Sbjct: 317 LYELALNQDVQKKLREEINTFCPKNNKELKYDDIKEMEYL 356 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 21.4 bits (43), Expect = 6.1 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 300 VPHPPRSISGT 268 VP PPRS+ G+ Sbjct: 56 VPQPPRSLEGS 66 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 6.1 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 519 HQVLDLWQDHGHDDVFLMSFIQVHT 445 HQ+ L Q H L SF+Q H+ Sbjct: 72 HQMQQLLQQHILSPTQLQSFMQQHS 96 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 362 SVRASSGPTACCSS 321 S ASS PT+ CSS Sbjct: 594 SSSASSAPTSVCSS 607 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 8.1 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 235 YPRVPAEKPQQHMPLR 188 YP + E P+ H P+R Sbjct: 70 YPLLRFENPETHHPIR 85 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,231 Number of Sequences: 438 Number of extensions: 2888 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -