Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0455
         (353 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_863| Best HMM Match : C2 (HMM E-Value=5.4e-36)                      26   7.7  

>SB_863| Best HMM Match : C2 (HMM E-Value=5.4e-36)
          Length = 454

 Score = 26.2 bits (55), Expect = 7.7
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
 Frame = +2

Query: 56  GKFGLVMNY*LYPIYSRCFLFYLLILIHNISLIMI--RKIFVLL*NTH 193
           G FG VM +  +P+++    F  +IL  N SL  +  R I V+L + H
Sbjct: 288 GSFGKVMPFTNHPLFTLSARFIQVILFTNRSLFTLSARVIQVILFSNH 335


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,916,671
Number of Sequences: 59808
Number of extensions: 109832
Number of successful extensions: 276
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 144
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 266
length of database: 16,821,457
effective HSP length: 73
effective length of database: 12,455,473
effective search space used: 548040812
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)