BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0454 (831 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 25 0.65 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 25 0.86 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 25 0.86 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 25 0.86 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 25 0.86 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 25 0.86 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 25 0.86 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 25 0.86 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 25 0.86 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 25 1.1 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 24 2.0 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 4.6 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 4.6 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 6.0 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 25.4 bits (53), Expect = 0.65 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = -2 Query: 812 SKHSQSYTHNNCRYIIQKRITFSHYDNTTNHNWYKFTALEYQLSWIVQI 666 S S +Y ++N +++Y+N N+N+ K L Y +++I QI Sbjct: 316 SSLSNNYKYSNYNNYNNNYNNYNNYNNNYNNNYKK---LYYNINYIEQI 361 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 0.86 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -2 Query: 749 FSHYDNTTNHNWYKFTALEYQLSWIVQI 666 +++Y+N N+N YK L Y +++I QI Sbjct: 94 YNNYNNNNNYNNYK--KLYYNINYIEQI 119 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 25.0 bits (52), Expect = 0.86 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -2 Query: 749 FSHYDNTTNHNWYKFTALEYQLSWIVQI 666 +++Y+N N+N YK L Y +++I QI Sbjct: 94 YNNYNNNNNYNNYK--KLYYNINYIEQI 119 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 0.86 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -2 Query: 749 FSHYDNTTNHNWYKFTALEYQLSWIVQI 666 +++Y+N N+N YK L Y +++I QI Sbjct: 94 YNNYNNNNNYNNYK--KLYYNINYIEQI 119 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 0.86 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -2 Query: 749 FSHYDNTTNHNWYKFTALEYQLSWIVQI 666 +++Y+N N+N YK L Y +++I QI Sbjct: 94 YNNYNNNNNYNNYK--KLYYNINYIEQI 119 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 0.86 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -2 Query: 749 FSHYDNTTNHNWYKFTALEYQLSWIVQI 666 +++Y+N N+N YK L Y +++I QI Sbjct: 94 YNNYNNNNNYNNYK--KLYYNINYIEQI 119 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 0.86 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -2 Query: 749 FSHYDNTTNHNWYKFTALEYQLSWIVQI 666 +++Y+N N+N YK L Y +++I QI Sbjct: 94 YNNYNNNNNYNNYK--KLYYNINYIEQI 119 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 0.86 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -2 Query: 749 FSHYDNTTNHNWYKFTALEYQLSWIVQI 666 +++Y+N N+N YK L Y +++I QI Sbjct: 94 YNNYNNNNNYNNYK--KLYYNINYIEQI 119 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 0.86 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -2 Query: 749 FSHYDNTTNHNWYKFTALEYQLSWIVQI 666 +++Y+N N+N YK L Y +++I QI Sbjct: 94 YNNYNNNNNYNNYK--KLYYNINYIEQI 119 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 24.6 bits (51), Expect = 1.1 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 536 YYVVELWRIMDKKSYQK--ESSTKNVCSFSCIDIRNNVIFEFSFKL 667 YYV+ LW +D+ S K + K + F+C + N I +F + Sbjct: 276 YYVMSLWYWIDRNSAYKIDQRIQKGLFLFACTNSCMNPIVYGAFNI 321 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.8 bits (49), Expect = 2.0 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -2 Query: 812 SKHSQSYTHNNCRYIIQKRITFSHYDNTTNHNWYKFTALEYQLSWIVQI 666 S S HNN Y ++Y+N N+N+ + L Y + I QI Sbjct: 316 SSLSNKTIHNNNNY--NNNNYNNNYNNYNNNNYNNYKKLYYNIINIEQI 362 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.6 bits (46), Expect = 4.6 Identities = 14/61 (22%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Frame = +3 Query: 351 SKTEINILCFDITNYSQLTQFLCCSIFVF----IFYLAYGYFLELIFAKPEVKPVSLYIT 518 + TE+N F + + T C + + Y+ F +L+F+K + K + +IT Sbjct: 326 TNTELNPNTFILVAENNTTMVFCNDLSIDRSTNTMYVLSDNFQQLLFSKYDAKKRNFFIT 385 Query: 519 L 521 + Sbjct: 386 M 386 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.6 bits (46), Expect = 4.6 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = -2 Query: 761 KRITFSHYDNTTNHNWYKFTALEYQLSWIVQI 666 K +++Y+N N+N+ + Y ++I+ I Sbjct: 323 KYSNYNNYNNYNNNNYNNYNKKLYYKNYIINI 354 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 6.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 Query: 797 SYTHNNCRYIIQKRITFSHYDNTTNHN 717 S +++ Y++ I FSHYD N N Sbjct: 228 SQDNHSKEYLVS--IMFSHYDRNNNGN 252 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,867 Number of Sequences: 438 Number of extensions: 4718 Number of successful extensions: 20 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26581563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -