BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0453 (673 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000D558F3 Cluster: PREDICTED: similar to CG31299-PA... 37 0.51 UniRef50_Q5KB21 Cluster: DNA-(Apurinic or apyrimidinic site) lya... 33 8.3 >UniRef50_UPI0000D558F3 Cluster: PREDICTED: similar to CG31299-PA, isoform A; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG31299-PA, isoform A - Tribolium castaneum Length = 476 Score = 36.7 bits (81), Expect = 0.51 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 192 AYRDCETASLSGFKLKPPYTLWRIHLS*RVCRT 290 AY DC+++S + +PPYT W+I VC T Sbjct: 390 AYADCDSSSANSAAREPPYTTWKIRDEGEVCHT 422 >UniRef50_Q5KB21 Cluster: DNA-(Apurinic or apyrimidinic site) lyase, putative; n=1; Filobasidiella neoformans|Rep: DNA-(Apurinic or apyrimidinic site) lyase, putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 654 Score = 32.7 bits (71), Expect = 8.3 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = +3 Query: 312 LVG-ASVEKQPRDVGEGPVLPSSEQNTLH*PLRR 410 LVG ++ +QP D GEGPV S+EQ+ H P RR Sbjct: 205 LVGDINIVRQPMDSGEGPVRSSAEQHYSH-PARR 237 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 591,199,469 Number of Sequences: 1657284 Number of extensions: 10668755 Number of successful extensions: 20145 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20140 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 51652897375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -