BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0453 (673 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9E9.09c |||aldehyde dehydrogenase|Schizosaccharomyces pombe|... 27 3.3 SPBC216.02 |mcp5|num1, mug21|cortical anchoring factor for dynei... 25 7.5 SPAC9G1.13c |||histone acetyltransferase complex subunit Swc4 |S... 25 9.9 >SPAC9E9.09c |||aldehyde dehydrogenase|Schizosaccharomyces pombe|chr 1|||Manual Length = 503 Score = 26.6 bits (56), Expect = 3.3 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 191 CISRLRDCVAFRVQVEASLYTLED 262 C+SRL DC+ ++ AS+ TL++ Sbjct: 90 CLSRLADCIEQNLEYLASIETLDN 113 >SPBC216.02 |mcp5|num1, mug21|cortical anchoring factor for dynein Mcp5/Num1|Schizosaccharomyces pombe|chr 2|||Manual Length = 968 Score = 25.4 bits (53), Expect = 7.5 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = -2 Query: 426 REFSDIALMVNVTCSAQNLATPVLHPHLGVASLRKPRLIKFKFQKKS 286 R+ +++ + + TC+A ++ + H +G ++ PR FK KKS Sbjct: 823 RDNLNLSGLSSSTCNANSVNKLMKHVMMGNEMMKYPRSESFKMFKKS 869 >SPAC9G1.13c |||histone acetyltransferase complex subunit Swc4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 25.0 bits (52), Expect = 9.9 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -2 Query: 357 LHPHLGVASLRKPRLIKFKFQKKSDILSNLNVSSRV 250 LHP V S + P + Q+ S +++ L VSSR+ Sbjct: 316 LHPGTFVRSQKIPAIKASLSQRVSSVMTELGVSSRL 351 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,529,445 Number of Sequences: 5004 Number of extensions: 47955 Number of successful extensions: 92 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -