BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0453 (673 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 23 6.6 CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 23 8.8 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.4 bits (48), Expect = 6.6 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 432 NFREFSDIALMVNVTCSAQNLATPVLHPHLGVASLRK 322 NFRE A +T S+ + P HP+ ++ L++ Sbjct: 262 NFREAIPEAYFPKITRSSDGRSYPARHPNETLSDLKR 298 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -2 Query: 474 LKCWTGLIVRETRINFREFSDIALMVNVT 388 L C GL +RE N+ E + +N T Sbjct: 256 LACLDGLFIREKERNWEESKETETNINPT 284 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 619,372 Number of Sequences: 2352 Number of extensions: 11649 Number of successful extensions: 57 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -