BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0450 (764 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 26 1.5 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 1.9 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 7.8 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 7.8 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 25.8 bits (54), Expect = 1.5 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = +2 Query: 167 QVCKDNIHLSSQRRQVGGKVLEWRPRMGTR 256 Q+ KD + S++ ++GG+++ W P + +R Sbjct: 350 QMYKDLLQFSARHLKLGGRLVCWFPMLSSR 379 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.4 bits (53), Expect = 1.9 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -1 Query: 386 LPTAGHRPSPMPST*CGPPPS 324 LP A P+P P GPPPS Sbjct: 576 LPNAQPPPAPPPPPPMGPPPS 596 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.4 bits (48), Expect = 7.8 Identities = 16/59 (27%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = -1 Query: 383 PTAGHRPSPMPST*CGPPPSASNDFPPCALSRQSTGLEDAPRSLYPSVASIR-GLSPPP 210 P H P PS PP S S R + + +P +IR +SP P Sbjct: 107 PHHQHHPQQQPSPQTSPPASISFSITNILSDRFGKATAEQQQQPHPQSPAIREPISPGP 165 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.4 bits (48), Expect = 7.8 Identities = 16/59 (27%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = -1 Query: 383 PTAGHRPSPMPST*CGPPPSASNDFPPCALSRQSTGLEDAPRSLYPSVASIR-GLSPPP 210 P H P PS PP S S R + + +P +IR +SP P Sbjct: 107 PHHQHHPQQQPSPQTSPPASISFSITNILSDRFGKATAEQQQQPHPQSPAIREPISPGP 165 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 778,266 Number of Sequences: 2352 Number of extensions: 15968 Number of successful extensions: 43 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -