BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0447 (574 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41016| Best HMM Match : RPEL (HMM E-Value=8.9) 68 6e-12 SB_39882| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_28599| Best HMM Match : MSSP (HMM E-Value=6.8) 68 6e-12 SB_52707| Best HMM Match : RPEL (HMM E-Value=8.9) 68 6e-12 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 68 6e-12 SB_30254| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_10424| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 8e-12 SB_45856| Best HMM Match : DUF755 (HMM E-Value=4.7) 66 3e-11 SB_12256| Best HMM Match : TP1 (HMM E-Value=8.5) 66 3e-11 SB_18779| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6264| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_22121| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_10239| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42346| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_36138| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_15035| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_25175| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_49084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34898| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46955| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.095 SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) 33 0.13 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 33 0.17 SB_45983| Best HMM Match : HLH (HMM E-Value=1.3) 31 0.51 SB_40561| Best HMM Match : Keratin_B2 (HMM E-Value=1.1) 30 1.2 SB_6379| Best HMM Match : Proteasome (HMM E-Value=0) 29 2.0 SB_52000| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_9945| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_45246| Best HMM Match : zf-MYND (HMM E-Value=0.19) 27 8.2 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3408 Score = 70.1 bits (164), Expect = 1e-12 Identities = 34/57 (59%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = +1 Query: 271 CLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRS-GVNLRNSNE 438 CL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE KS R G+ L+ + Sbjct: 725 CLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELKSARQRRLGLGLKGGGK 781 >SB_41016| Best HMM Match : RPEL (HMM E-Value=8.9) Length = 148 Score = 67.7 bits (158), Expect = 6e-12 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = +1 Query: 271 CLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 435 CL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 62 CLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 112 >SB_39882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 67.7 bits (158), Expect = 6e-12 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = +1 Query: 271 CLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 435 CL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 8 CLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 58 >SB_28599| Best HMM Match : MSSP (HMM E-Value=6.8) Length = 148 Score = 67.7 bits (158), Expect = 6e-12 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = +1 Query: 271 CLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 435 CL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 62 CLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 112 >SB_52707| Best HMM Match : RPEL (HMM E-Value=8.9) Length = 147 Score = 67.7 bits (158), Expect = 6e-12 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = +1 Query: 271 CLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 435 CL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 61 CLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 111 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 67.7 bits (158), Expect = 6e-12 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = +1 Query: 271 CLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 435 CL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 120 CLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 170 >SB_30254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 67.7 bits (158), Expect = 6e-12 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = +1 Query: 271 CLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 435 CL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 19 CLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 69 >SB_10424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 67.3 bits (157), Expect = 8e-12 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +1 Query: 271 CLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFK 393 CL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K Sbjct: 36 CLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK 76 >SB_45856| Best HMM Match : DUF755 (HMM E-Value=4.7) Length = 187 Score = 65.7 bits (153), Expect = 3e-11 Identities = 33/46 (71%), Positives = 34/46 (73%), Gaps = 4/46 (8%) Frame = -3 Query: 374 VLFNFPSRYLFAIGLAVIFSLRWSLPPA*GCTLKQPDS----KERP 249 VLF FPSRYLFAIGL IFS RWSLPP GC KQPDS +ERP Sbjct: 89 VLFIFPSRYLFAIGLVPIFSFRWSLPPILGCIPKQPDSSKAHRERP 134 >SB_12256| Best HMM Match : TP1 (HMM E-Value=8.5) Length = 156 Score = 65.7 bits (153), Expect = 3e-11 Identities = 33/46 (71%), Positives = 34/46 (73%), Gaps = 4/46 (8%) Frame = -3 Query: 374 VLFNFPSRYLFAIGLAVIFSLRWSLPPA*GCTLKQPDS----KERP 249 VLF FPSRYLFAIGL IFS RWSLPP GC KQPDS +ERP Sbjct: 58 VLFIFPSRYLFAIGLVPIFSFRWSLPPILGCIPKQPDSSKAHRERP 103 >SB_18779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 60.1 bits (139), Expect = 1e-09 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +1 Query: 295 GGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 435 GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 44 >SB_6264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 60.1 bits (139), Expect = 1e-09 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +1 Query: 295 GGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 435 GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 44 >SB_22121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 59.7 bits (138), Expect = 2e-09 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +1 Query: 295 GGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 435 GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 2 GGKLHLKLNIGKRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 44 >SB_10239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 59.7 bits (138), Expect = 2e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 295 GGKLHLRLNMTARPIANKYREGKLKRTLKREFK 393 GGKLHL+LN+ RPIANKYREGK+K TLKRE K Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLKRELK 34 >SB_42346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 59.7 bits (138), Expect = 2e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 295 GGKLHLRLNMTARPIANKYREGKLKRTLKREFK 393 GGKLHL+LN+ RPIANKYREGK+K TLKRE K Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLKRELK 34 >SB_36138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 56.0 bits (129), Expect = 2e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 295 GGKLHLRLNMTARPIANKYREGKLKRTLKREFK 393 GGKLHL+LN+ RPIANKYREGK+K TLK+ K Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLKKRVK 34 Score = 31.9 bits (69), Expect = 0.38 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +3 Query: 357 GKVEKNFEERVQEYVKPFRGKP 422 GK++ ++RV++YVKP +GKP Sbjct: 23 GKMKSTLKKRVKKYVKPLKGKP 44 >SB_15035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 56.0 bits (129), Expect = 2e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 295 GGKLHLRLNMTARPIANKYREGKLKRTLKREFK 393 GGKLHL+LN+ RPIANKYREGK+K TLK+ K Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLKKRVK 34 Score = 29.1 bits (62), Expect = 2.7 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +3 Query: 357 GKVEKNFEERVQEYVKPFRGK 419 GK++ ++RV++YVKP +GK Sbjct: 23 GKMKSTLKKRVKKYVKPLKGK 43 >SB_25175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 54.4 bits (125), Expect = 6e-08 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 295 GGKLHLRLNMTARPIANKYREGKLKRTLKREFK 393 GGKLHL+LN+ RPIANKYREGK+K TL++ K Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLEKRVK 34 Score = 30.7 bits (66), Expect = 0.88 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +3 Query: 357 GKVEKNFEERVQEYVKPFRGK 419 GK++ E+RV++YVKP +GK Sbjct: 23 GKMKSTLEKRVKKYVKPLKGK 43 >SB_49084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 50.0 bits (114), Expect = 1e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 295 GGKLHLRLNMTARPIANKYREGKLKRTL 378 GGKLHL+LN+ RPIANKYREG++K TL Sbjct: 2 GGKLHLKLNIGTRPIANKYREGQMKSTL 29 >SB_34898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = +1 Query: 295 GGKLHLRLNMTARPIANKYREGKLKRTLKREFK 393 GGKLHL+LN+ RPIANKYREGK ++ ++ K Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKDEKHFEKRVK 34 Score = 34.3 bits (75), Expect = 0.072 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +3 Query: 357 GKVEKNFEERVQEYVKPFRGKPAKLE*TNGEIH 455 GK EK+FE+RV++YVK +GK L IH Sbjct: 23 GKDEKHFEKRVKKYVKTLKGKRMGLAMRRARIH 55 >SB_46955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 35.5 bits (78), Expect = 0.031 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -3 Query: 347 LFAIGLAVIFSLRWSLPPA*GCTLKQPDSKERPSRR 240 + I + ++ + RWSLPP GC KQPDS + +R Sbjct: 23 IIIIIIILLHTRRWSLPPILGCIPKQPDSSKAHRKR 58 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 33.9 bits (74), Expect = 0.095 Identities = 25/61 (40%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -1 Query: 316 ALDGVYHPLRAALSSNPTLRS-VPLAATLRRYGPGTLYGKTAPFKTNLDRSRRDEKAEPP 140 ALDG YHP AA +NPT R + RR G L + P +NLD EK +P Sbjct: 58 ALDGFYHPFWAAFPNNPTRRKHIVNGRDRRRRGCHPL-RRAVP--SNLDDLGSAEKGDPL 114 Query: 139 E 137 E Sbjct: 115 E 115 >SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) Length = 139 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/25 (64%), Positives = 17/25 (68%), Gaps = 4/25 (16%) Frame = -3 Query: 311 RWSLPPA*GCTLKQPDS----KERP 249 RWSLPP GC KQPDS +ERP Sbjct: 62 RWSLPPILGCIPKQPDSSKAHRERP 86 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -1 Query: 316 ALDGVYHPLRAALSSNPTLR 257 ALDGVYHP AA +NPT R Sbjct: 58 ALDGVYHPFWAAFPNNPTRR 77 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -1 Query: 316 ALDGVYHPLRAALSSNPTLR 257 ALDGVYHP AA +NPT R Sbjct: 344 ALDGVYHPFWAAFPNNPTRR 363 >SB_45983| Best HMM Match : HLH (HMM E-Value=1.3) Length = 68 Score = 31.5 bits (68), Expect = 0.51 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 313 LDGVYHPLRAALSSNPTLR 257 LDGVYHP AA +NPT R Sbjct: 2 LDGVYHPFWAAFPNNPTRR 20 >SB_40561| Best HMM Match : Keratin_B2 (HMM E-Value=1.1) Length = 1139 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/72 (27%), Positives = 33/72 (45%) Frame = -2 Query: 336 RSRGHI*P*MEFTTRLGLHSQATRL*GASLSPRPSVATGLAPSTGKRPRSRRTWTGVVAT 157 RSR P RL H+ + L + P P T + + + T +G++++ Sbjct: 148 RSRKRPAPITTTNHRLNCHTNSVIL-SSRKRPAPITTTPITTTITNHRLNCHTNSGILSS 206 Query: 156 RKRNLPNTTSPV 121 RKR P TT+P+ Sbjct: 207 RKRPAPITTTPI 218 >SB_6379| Best HMM Match : Proteasome (HMM E-Value=0) Length = 909 Score = 29.5 bits (63), Expect = 2.0 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = -1 Query: 346 CSLSVSRSYLALDGVYHPLRAALSSNPTLRSVPLAATLRRYGPGTLYGKTAPFKTNL 176 C L S D + + +R+A ++ P LR P AA L R+G G T P + +L Sbjct: 765 CKLFPSAPLGVADPLPYTIRSAGATQPGLRLRPYAADLARHGEGA--ALTEPLEVHL 819 >SB_52000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 29.1 bits (62), Expect = 2.7 Identities = 10/19 (52%), Positives = 17/19 (89%) Frame = +3 Query: 363 VEKNFEERVQEYVKPFRGK 419 ++ +FE+RV++YVKP +GK Sbjct: 1 MKSHFEKRVKKYVKPLKGK 19 >SB_9945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +3 Query: 375 FEERVQEYVKPFRGK 419 FE+RV++YVKP +GK Sbjct: 5 FEKRVKKYVKPLKGK 19 >SB_45246| Best HMM Match : zf-MYND (HMM E-Value=0.19) Length = 1828 Score = 27.5 bits (58), Expect = 8.2 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -1 Query: 187 KTNLDRSRRDEKAEPPEHHISRYRLKQRDSV-LGYIPVRSPLLRKSWLVSFPP 32 KT S + P +RYR++ RDSV ++ R+P S L++F P Sbjct: 364 KTANATSSATNTTDLPRRRGTRYRIRARDSVDKSFVKFRNPNPSFSGLLTFEP 416 >SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 309 MEFTTRLGLHSQAT 268 MEFTT GLHSQ T Sbjct: 1 MEFTTHFGLHSQTT 14 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,372,562 Number of Sequences: 59808 Number of extensions: 337922 Number of successful extensions: 969 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 955 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1361520496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -