BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0446 (672 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 23 1.7 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 23 3.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.2 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 23.4 bits (48), Expect = 1.7 Identities = 13/62 (20%), Positives = 28/62 (45%) Frame = +3 Query: 159 QTKLLLG*ETNKKKQLSHFFHKNNRVFFVWQH*IIHDSFKSST*RSFLNQYSKCTFKI*I 338 +T L + +K + H + NN ++ + I++S + S + +LN + + Sbjct: 20 KTNPFLASDCDKNQNTEHNYTHNNEMYHSVKEEPIYESCRFSINQPYLNHFDNSVTPMVN 79 Query: 339 HD 344 HD Sbjct: 80 HD 81 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 184 KLTKKNNFLIFSTKIIVFFSYGNIRL 261 KLT + + +I TKI FS G +++ Sbjct: 85 KLTNRESSIIDKTKISFNFSQGPVKI 110 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = +3 Query: 123 FLTLQYAVKFYSQ 161 FL++ YAVKF+++ Sbjct: 393 FLSVDYAVKFWTK 405 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,111 Number of Sequences: 336 Number of extensions: 2704 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -