BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0445 (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 25 0.37 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 25 0.37 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 25 0.37 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 25 0.37 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.5 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 7.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 7.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.9 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 25.4 bits (53), Expect = 0.37 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 316 LSLNTWVYDLEKYIYDNNIAPIIKKNGKPVPNYDEVRY 429 +SL W E YI ++ P IKK GK N ++ RY Sbjct: 263 VSLGWW----ENYISRHSPIPFIKKLGKIKENLEQSRY 296 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 25.4 bits (53), Expect = 0.37 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 316 LSLNTWVYDLEKYIYDNNIAPIIKKNGKPVPNYDEVRY 429 +SL W E YI ++ P IKK GK N ++ RY Sbjct: 263 VSLGWW----ENYISRHSPIPFIKKLGKIKENLEQSRY 296 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 25.4 bits (53), Expect = 0.37 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 316 LSLNTWVYDLEKYIYDNNIAPIIKKNGKPVPNYDEVRY 429 +SL W E YI ++ P IKK GK N ++ RY Sbjct: 263 VSLGWW----ENYISRHSPIPFIKKLGKIKENLEQSRY 296 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 25.4 bits (53), Expect = 0.37 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 316 LSLNTWVYDLEKYIYDNNIAPIIKKNGKPVPNYDEVRY 429 +SL W E YI ++ P IKK GK N ++ RY Sbjct: 263 VSLGWW----ENYISRHSPIPFIKKLGKIKENLEQSRY 296 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 Query: 510 TNGFVINRYLNRIS 469 TNG VINR R+S Sbjct: 648 TNGIVINRASKRVS 661 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 499 CN*SVP*SHLPTRHENYRAVKIH 431 C+ + HL +H+NY ++ H Sbjct: 17 CSHRIVREHLGLKHDNYYELETH 39 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 499 CN*SVP*SHLPTRHENYRAVKIH 431 C+ + HL +H+NY ++ H Sbjct: 331 CSHRIVREHLGLKHDNYYELETH 353 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 499 CN*SVP*SHLPTRHENYRAVKIH 431 C+ + HL +H+NY ++ H Sbjct: 564 CSHRIVREHLGLKHDNYYELETH 586 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 499 CN*SVP*SHLPTRHENYRAVKIH 431 C+ + HL +H+NY ++ H Sbjct: 564 CSHRIVREHLGLKHDNYYELETH 586 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,845 Number of Sequences: 336 Number of extensions: 3569 Number of successful extensions: 13 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -