BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0443 (774 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z50794-2|CAA90657.2| 681|Caenorhabditis elegans Hypothetical pr... 29 4.9 AL031630-8|CAA20989.1| 282|Caenorhabditis elegans Hypothetical ... 28 6.4 >Z50794-2|CAA90657.2| 681|Caenorhabditis elegans Hypothetical protein F59F5.3 protein. Length = 681 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = -1 Query: 636 FIKDIRLDP---FYQCVHSDVPIRFENKEIFNRKYRN 535 F DI +P FYQC H+D I F+ + + N Y N Sbjct: 189 FYIDISRNPINRFYQCEHNDELISFKLQNMANNGYEN 225 >AL031630-8|CAA20989.1| 282|Caenorhabditis elegans Hypothetical protein Y38H6C.9 protein. Length = 282 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -1 Query: 348 RIIFLQSLLRFDITFFFVFNFLHFPKTVPSSVCSVE 241 R++ Q LL+FD +F ++FL + + S+C +E Sbjct: 149 RVLSEQQLLKFDSSFKVNYDFLQHAERLELSLCDLE 184 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,288,142 Number of Sequences: 27780 Number of extensions: 347543 Number of successful extensions: 771 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1861650246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -