BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0442 (709 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 22 5.0 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 8.7 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 8.7 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 8.7 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 121 PRAARG*RKKIPKSCQRLKKEDP 189 PR+ + KK+ C+ ++ EDP Sbjct: 85 PRSMQDSTKKLFNKCKSIQNEDP 107 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.7 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = -3 Query: 209 LQLWQLLGSSFFNLWQLLGIFFLQPLAALGLFFLQPLASLGLFFLQPLA 63 L +W+ +S + +L L L +F +PL + FF+ LA Sbjct: 31 LPVWEAAAASLTLGFLVLATVLGNALVILSVFTYRPLRIVQNFFIVSLA 79 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.7 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = -3 Query: 209 LQLWQLLGSSFFNLWQLLGIFFLQPLAALGLFFLQPLASLGLFFLQPLA 63 L +W+ +S + +L L L +F +PL + FF+ LA Sbjct: 31 LPVWEAAAASLTLGFLVLATVLGNALVILSVFTYRPLRIVQNFFIVSLA 79 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.7 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = -3 Query: 209 LQLWQLLGSSFFNLWQLLGIFFLQPLAALGLFFLQPLASLGLFFLQPLA 63 L +W+ +S + +L L L +F +PL + FF+ LA Sbjct: 31 LPVWEAAAASLTLGFLVLATVLGNALVILSVFTYRPLRIVQNFFIVSLA 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,438 Number of Sequences: 438 Number of extensions: 2217 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -