BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0437 (739 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 71 6e-13 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 69 3e-12 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 68 8e-12 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 68 8e-12 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 66 2e-11 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 64 9e-11 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 64 1e-10 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 64 1e-10 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 62 3e-10 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 62 5e-10 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 61 7e-10 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 61 9e-10 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 61 9e-10 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 58 6e-09 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 58 6e-09 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 54 7e-08 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 53 2e-07 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 51 7e-07 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 50 2e-06 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 48 5e-06 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 48 9e-06 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 47 1e-05 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 46 3e-05 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 46 3e-05 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 45 6e-05 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 45 6e-05 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 44 1e-04 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 44 1e-04 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 43 2e-04 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 42 3e-04 At5g61340.1 68418.m07697 expressed protein 42 6e-04 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 42 6e-04 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 41 0.001 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 41 0.001 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 40 0.002 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 40 0.002 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 40 0.002 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 39 0.004 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 38 0.007 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 38 0.009 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 38 0.009 At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 38 0.009 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 38 0.009 At1g76080.1 68414.m08835 thioredoxin family protein low similari... 37 0.012 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 37 0.016 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 37 0.016 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 36 0.028 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 36 0.037 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 36 0.037 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 34 0.086 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 33 0.15 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 33 0.15 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 32 0.35 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 32 0.35 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 32 0.35 At3g03860.1 68416.m00398 expressed protein 32 0.46 At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH... 32 0.46 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 29 3.2 At4g30290.1 68417.m04305 xyloglucan:xyloglucosyl transferase, pu... 28 5.6 At4g30280.1 68417.m04304 xyloglucan:xyloglucosyl transferase, pu... 28 5.6 At1g65310.1 68414.m07406 xyloglucan:xyloglucosyl transferase, pu... 28 5.6 At1g43100.1 68414.m04965 glycoside hydrolase family 28 protein /... 28 5.6 At1g43090.1 68414.m04964 glycoside hydrolase family 28 protein /... 28 5.6 At4g31240.2 68417.m04435 expressed protein 28 7.4 At4g31240.1 68417.m04434 expressed protein 28 7.4 At1g78740.1 68414.m09177 hypothetical protein 27 9.8 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 27 9.8 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 71.3 bits (167), Expect = 6e-13 Identities = 32/91 (35%), Positives = 50/91 (54%) Frame = +1 Query: 28 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXX 207 H D ++ A+ +KL+VIDF A+WC PC+MI P +++A + Sbjct: 12 HTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDEL 71 Query: 208 XXXASEYNINSMPTFVFVKNGKKLDEFSGAN 300 A E+ + +MPTFVF+K G+ +D+ GAN Sbjct: 72 QSVAKEFGVEAMPTFVFIKAGEVVDKLVGAN 102 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 68.9 bits (161), Expect = 3e-12 Identities = 35/96 (36%), Positives = 54/96 (56%), Gaps = 2/96 (2%) Frame = +1 Query: 25 IHIKDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 198 + IK+ + K+RL D KL+VI+F A WCGPCK + PKL+E+AA+ Sbjct: 40 VEIKNMNQWKSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFVKIDVD 99 Query: 199 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGANVD 306 E+N++++P VF+K G+++D G VD Sbjct: 100 VLMSVW-MEFNLSTLPAIVFMKRGREVDMVVGVKVD 134 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 67.7 bits (158), Expect = 8e-12 Identities = 31/94 (32%), Positives = 53/94 (56%) Frame = +1 Query: 19 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 198 +SIH + KT+ A+ +L+++ F ATWCGPC+ + P +A + Sbjct: 273 ISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHSRVVFLKVDID 332 Query: 199 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 300 AS +NI+S+PTF F+++GK++D+ GA+ Sbjct: 333 KANDVAAS-WNISSVPTFCFIRDGKEVDKVVGAD 365 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 67.7 bits (158), Expect = 8e-12 Identities = 29/79 (36%), Positives = 45/79 (56%) Frame = +1 Query: 61 LAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINS 240 L + DK V++DF ATWCGPC+++ P L+E++ + A++Y I + Sbjct: 71 LLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYPSLANKYQIEA 130 Query: 241 MPTFVFVKNGKKLDEFSGA 297 +PTF+ K+GK D F GA Sbjct: 131 LPTFILFKDGKLWDRFEGA 149 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/77 (38%), Positives = 44/77 (57%) Frame = +1 Query: 76 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 255 +KL+V+DF A+WCGPC+MI P + + A+ A E+N+ +MPTFV Sbjct: 47 NKLLVVDFSASWCGPCRMIEPAIHAM-ADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFV 105 Query: 256 FVKNGKKLDEFSGANVD 306 VK GK+++ GA D Sbjct: 106 LVKRGKEIERIIGAKKD 122 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 64.1 bits (149), Expect = 9e-11 Identities = 33/92 (35%), Positives = 50/92 (54%) Frame = +1 Query: 25 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 204 I K+S D K A+ K+VV +F ATWCGPCK++ P E+ +E Sbjct: 28 ITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIEL-SEKHSSLMFLLVDVDE 86 Query: 205 XXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 300 +S ++I + PTF F+KNG+++ + GAN Sbjct: 87 LSDFSSSWDIKATPTFFFLKNGQQIGKLVGAN 118 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 63.7 bits (148), Expect = 1e-10 Identities = 32/96 (33%), Positives = 52/96 (54%) Frame = +1 Query: 19 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 198 ++ H ++ + + + A LVV+DF A+WCGPC+ I P ++A ++ Sbjct: 9 IACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKL-PNVLFLKVDT 67 Query: 199 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGANVD 306 AS++ I +MPTF+F+K GK LD+ GA D Sbjct: 68 DELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKD 103 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 63.7 bits (148), Expect = 1e-10 Identities = 26/74 (35%), Positives = 42/74 (56%) Frame = +1 Query: 76 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 255 DK V++D+ ATWCGPC+ + P L+E++ + A++Y I ++PTF+ Sbjct: 81 DKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKYKIEALPTFI 140 Query: 256 FVKNGKKLDEFSGA 297 K+G+ D F GA Sbjct: 141 LFKDGEPCDRFEGA 154 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 62.5 bits (145), Expect = 3e-10 Identities = 30/90 (33%), Positives = 43/90 (47%) Frame = +1 Query: 37 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXX 216 D D + AGDK+VV+D WCGPCK+I PK E++ + Sbjct: 84 DKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLKLDCNQDNKPL 143 Query: 217 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 306 A E I +PTF +K+ K + E +GA + Sbjct: 144 AKELGIRVVPTFKILKDNKVVKEVTGAKYE 173 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 61.7 bits (143), Expect = 5e-10 Identities = 30/80 (37%), Positives = 43/80 (53%) Frame = +1 Query: 67 EAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMP 246 + +KL+VIDF A WCGPCK + P++ EIA++ A Y ++P Sbjct: 40 KGSNKLLVIDFTAVWCGPCKAMEPRVREIASK-YSEAVFARVDVDRLMDVAGTYRAITLP 98 Query: 247 TFVFVKNGKKLDEFSGANVD 306 FVFVK G+++D GA D Sbjct: 99 AFVFVKRGEEIDRVVGAKPD 118 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 61.3 bits (142), Expect = 7e-10 Identities = 31/85 (36%), Positives = 42/85 (49%) Frame = +1 Query: 52 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYN 231 K + A KL+VIDF A+WC PC+ I P E+A + A E+ Sbjct: 19 KVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKF-TNVVFFKIDVDELQAVAQEFK 77 Query: 232 INSMPTFVFVKNGKKLDEFSGANVD 306 + +MPTFVF+K G +D GA D Sbjct: 78 VEAMPTFVFMKEGNIIDRVVGAAKD 102 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 60.9 bits (141), Expect = 9e-10 Identities = 30/90 (33%), Positives = 49/90 (54%) Frame = +1 Query: 28 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXX 207 ++ DS+ +T++ E+ D V+++F A WCGPC+MI P +D++A + Sbjct: 90 NLSDSE-WQTKVLES-DVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDES 147 Query: 208 XXXASEYNINSMPTFVFVKNGKKLDEFSGA 297 A+ Y I S+PT + K G+K D GA Sbjct: 148 PNTANRYGIRSVPTVIIFKGGEKKDSIIGA 177 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 60.9 bits (141), Expect = 9e-10 Identities = 30/90 (33%), Positives = 42/90 (46%) Frame = +1 Query: 37 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXX 216 D D + AG+KLVV+D WCGPCK+I PK ++ + Sbjct: 74 DKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFLKLDCNPDNRPL 133 Query: 217 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 306 A E I +PTF +K+ K + E +GA D Sbjct: 134 AKELGIRVVPTFKILKDNKVVKEVTGAKYD 163 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 58.0 bits (134), Expect = 6e-09 Identities = 28/82 (34%), Positives = 41/82 (50%) Frame = +1 Query: 52 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYN 231 K + A KL+VIDF ATWC PC+ I P ++ A+ A E+ Sbjct: 19 KLKAANESKKLIVIDFTATWCPPCRFIAPVFADL-AKKHLDVVFFKVDVDELNTVAEEFK 77 Query: 232 INSMPTFVFVKNGKKLDEFSGA 297 + +MPTF+F+K G+ + GA Sbjct: 78 VQAMPTFIFMKEGEIKETVVGA 99 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 58.0 bits (134), Expect = 6e-09 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = +1 Query: 40 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA 219 +D L D+ V +DF A WCGPCKMI P ++E+A + Sbjct: 80 NDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPATP 139 Query: 220 SEYNINSMPTFVFVKNGKKLDEFSGA 297 +Y + S+PT + NG+K D GA Sbjct: 140 GQYGVRSIPTIMIFVNGEKKDTIIGA 165 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 54.4 bits (125), Expect = 7e-08 Identities = 24/71 (33%), Positives = 34/71 (47%) Frame = +1 Query: 85 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 264 VV+DF A WCGPCKMI P ++++A +Y + S+PT + Sbjct: 101 VVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFV 160 Query: 265 NGKKLDEFSGA 297 G+K D GA Sbjct: 161 GGEKKDTIIGA 171 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/70 (31%), Positives = 35/70 (50%) Frame = +1 Query: 85 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 264 V+++F +WCGPC+M+ +DEIA + A EY I ++P + K Sbjct: 87 VLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFK 146 Query: 265 NGKKLDEFSG 294 NG+K + G Sbjct: 147 NGEKRESIMG 156 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 51.2 bits (117), Expect = 7e-07 Identities = 19/65 (29%), Positives = 36/65 (55%) Frame = +1 Query: 85 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 264 V+++F+ATWCGPCK+I P ++ ++ E +E+ + +P F+ K Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFK 149 Query: 265 NGKKL 279 +GK++ Sbjct: 150 DGKEV 154 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/50 (44%), Positives = 31/50 (62%) Frame = +1 Query: 13 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE 162 P M I I ++ L +AGD+LV++DF TWCG C+ + PKL + A E Sbjct: 93 PNM-IDITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKE 141 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 48.4 bits (110), Expect = 5e-06 Identities = 32/98 (32%), Positives = 43/98 (43%), Gaps = 1/98 (1%) Frame = +1 Query: 10 KPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXX 189 KP M + DL L AGDKLVV+DF + CG CK + PK+ +I AE Sbjct: 92 KPNMK-SVTSPQDLVVSLRNAGDKLVVVDFFSPSCGGCKALHPKICKI-AEKNPEVEFLQ 149 Query: 190 XXXXXXXXXASEYNINSMPTFVFVKNGK-KLDEFSGAN 300 NI+ +P F F + ++ FS N Sbjct: 150 VNYEEHRSLCQSLNIHVLPFFRFYRGSSGRVCSFSCTN 187 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 47.6 bits (108), Expect = 9e-06 Identities = 23/79 (29%), Positives = 43/79 (54%) Frame = +1 Query: 64 AEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSM 243 A + K++V++F A+WC P K I P E+A+ + E+N+++ Sbjct: 58 ANSHGKILVVNFKASWCLPSKTILPIYQELAS-TYTSMIFVTIDVEELAEFSHEWNVDAT 116 Query: 244 PTFVFVKNGKKLDEFSGAN 300 PT VF+K+G+++D+ G + Sbjct: 117 PTVVFLKDGRQMDKLVGGD 135 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 46.8 bits (106), Expect = 1e-05 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 3/94 (3%) Frame = +1 Query: 31 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 204 +K ++ +++A D + V F A WCGPC+ I P + E++ + Sbjct: 89 VKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQYPDVTTYKVDIDEG 148 Query: 205 XXXXA-SEYNINSMPTFVFVKNGKKLDEFSGANV 303 S+ NI ++PT F K G K E GA+V Sbjct: 149 GISNTISKLNITAVPTLHFFKGGSKKGEVVGADV 182 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 45.6 bits (103), Expect = 3e-05 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%) Frame = +1 Query: 13 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 192 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVN 161 Query: 193 XXXXXXXXASEYNINSMPTFVFVKNGK-KLDEFS 291 S N+ +P F F + +L+ FS Sbjct: 162 FDENKPMCKS-LNVRVLPFFHFYRGADGQLESFS 194 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 45.6 bits (103), Expect = 3e-05 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%) Frame = +1 Query: 13 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 192 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVN 161 Query: 193 XXXXXXXXASEYNINSMPTFVFVKNGK-KLDEFS 291 S N+ +P F F + +L+ FS Sbjct: 162 FDENKPMCKS-LNVRVLPFFHFYRGADGQLESFS 194 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 44.8 bits (101), Expect = 6e-05 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 3/94 (3%) Frame = +1 Query: 31 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 204 +K + + L++A D + V F A WCGPC++I P + E++ + Sbjct: 54 LKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPDVTTYKVDIDEG 113 Query: 205 XXXXA-SEYNINSMPTFVFVKNGKKLDEFSGANV 303 A + N++++PT F K G K E G +V Sbjct: 114 GLSNAIGKLNVSAVPTLQFFKGGVKKAEIVGVDV 147 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 44.8 bits (101), Expect = 6e-05 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 1/91 (1%) Frame = +1 Query: 31 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXX 210 I + +L L AGDKLVV+DF + CG CK + PK+ + AEM Sbjct: 102 ISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQF-AEMNPDVQFLQVNYEEHK 160 Query: 211 XXASEYNINSMPTFVFVKNGK-KLDEFSGAN 300 ++ +P F F + + ++ FS N Sbjct: 161 SMCYSLGVHVLPFFRFYRGSQGRVCSFSCTN 191 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 43.6 bits (98), Expect = 1e-04 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +1 Query: 25 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 204 + I+ ++ L L AGD+LVV+DF + CG CK + PK+ ++ AE Sbjct: 88 LEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQL-AETNPNVMFLKVNQEE 146 Query: 205 XXXXASEYNINSMPTFVFVKNGK-KLDEFS 291 N++ +P F F + + K+ FS Sbjct: 147 LRTMCHGLNVHVLPFFKFYRGAEGKVCSFS 176 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/65 (30%), Positives = 34/65 (52%) Frame = +1 Query: 103 ATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVKNGKKLD 282 A WC PCK I P ++A+ ++E+N+ + PT VF+K+G+++D Sbjct: 17 APWCVPCKKIEPVFRDLASRYPSMIFVTVDVEELAEF-SNEWNVEATPTVVFLKDGRQMD 75 Query: 283 EFSGA 297 + GA Sbjct: 76 KLVGA 80 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +1 Query: 73 GDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMP 246 GD+ V ++DF ATWCGPC ++ +L+ +A E A + + +P Sbjct: 91 GDRKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLP 150 Query: 247 TFVFV 261 T F+ Sbjct: 151 TLFFI 155 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/74 (29%), Positives = 34/74 (45%) Frame = +1 Query: 85 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 264 +V F A WC P + +E+A AS+ + +MPTF+F+K Sbjct: 27 IVAHFTALWCIPSVFMNSFFEELAFNYKDALFLIVDVDEVKEV-ASQLEVKAMPTFLFLK 85 Query: 265 NGKKLDEFSGANVD 306 +G +D+ GAN D Sbjct: 86 DGNAMDKLVGANPD 99 >At5g61340.1 68418.m07697 expressed protein Length = 326 Score = 41.5 bits (93), Expect = 6e-04 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 2/71 (2%) Frame = -2 Query: 471 KLISSN-SLQTLKTFFIHLLKTYTC-FFFLIPS*FPSAAAYNFSLYLLVFKDSCFEFVDV 298 KL+S+N S + F++ LLKTY C FFFL+ SA A F+L+ L + + E Sbjct: 108 KLLSNNHSADSSSVFYLRLLKTYVCNFFFLL-----SANASAFALFFLAY--NTLEAFGF 160 Query: 297 SAREFVQFLAI 265 S+R F FL++ Sbjct: 161 SSRNFYTFLSL 171 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 6/76 (7%) Frame = +1 Query: 85 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 249 +V++F A WCG C+ + P+ ++ A+E+ A+EY I PT Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPT 108 Query: 250 FVFVKN-GKKLDEFSG 294 ++N GK + +++G Sbjct: 109 LKILRNGGKSVQDYNG 124 Score = 37.5 bits (83), Expect = 0.009 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 7/56 (12%) Frame = +1 Query: 10 KPKMSIHIKDSDDLKTRLAEAGD-------KLVVIDFMATWCGPCKMIGPKLDEIA 156 K I ++++ +K +AE+ D K V+I+F A WCG C+ + P LDE+A Sbjct: 361 KKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVA 416 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/72 (26%), Positives = 31/72 (43%) Frame = +1 Query: 82 LVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 261 +V+++F A WCG CK + P +++A + A +Y I PT Sbjct: 50 VVLVEFFAPWCGHCKALTPTWEKVANILKGVATVAAIDADAHQSAAQDYGIKGFPTIKVF 109 Query: 262 KNGKKLDEFSGA 297 GK ++ GA Sbjct: 110 VPGKAPIDYQGA 121 Score = 33.9 bits (74), Expect = 0.11 Identities = 19/84 (22%), Positives = 33/84 (39%), Gaps = 2/84 (2%) Frame = +1 Query: 10 KPKMSIHIKDS--DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXX 183 +P S+ + S DDL ++L +++F A WCG CK + P+ A + Sbjct: 160 EPSASVELNASNFDDLVIE----SNELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKL 215 Query: 184 XXXXXXXXXXXASEYNINSMPTFV 255 S + + PT + Sbjct: 216 GHVNCDVEQSIMSRFKVQGFPTIL 239 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/72 (25%), Positives = 37/72 (51%) Frame = +1 Query: 85 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 264 V++ F A WCGPC+ + P L+++ +E ++I+ +PT + K Sbjct: 230 VMVMFTARWCGPCRDMIPILNKMDSEYKNEFKFYTVNFDTEIRFTERFDISYLPTTLVFK 289 Query: 265 NGKKLDEFSGAN 300 G+++ + +GA+ Sbjct: 290 GGEQMAKVTGAD 301 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 6/76 (7%) Frame = +1 Query: 85 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 249 +V++F A WCG CK + P+ ++ A+ + A++Y + PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 250 F-VFVKNGKKLDEFSG 294 +F GK + E++G Sbjct: 110 IKIFRNGGKAVQEYNG 125 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +1 Query: 40 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 156 SD L + +G K V+++F A WCG C+ + P LDE+A Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVA 418 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 6/76 (7%) Frame = +1 Query: 85 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 249 +V++F A WCG CK + P+ ++ A+ + A++Y + PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 250 F-VFVKNGKKLDEFSG 294 +F GK + E++G Sbjct: 110 IKIFRNGGKAVQEYNG 125 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +1 Query: 40 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 156 SD L + +G K V+++F A WCG C+ + P LDE+A Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVA 418 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/72 (22%), Positives = 32/72 (44%) Frame = +1 Query: 82 LVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 261 +V+++F A WCG C+ + P +++A+ + + +Y + PT Sbjct: 48 VVLVEFFAPWCGHCQSLTPTWEKVASTLKGIATVAAIDADAHKSVSQDYGVRGFPTIKVF 107 Query: 262 KNGKKLDEFSGA 297 GK ++ GA Sbjct: 108 VPGKPPIDYQGA 119 Score = 35.9 bits (79), Expect = 0.028 Identities = 21/90 (23%), Positives = 36/90 (40%), Gaps = 2/90 (2%) Frame = +1 Query: 10 KPKMSIHIKDS--DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXX 183 +P S+ + S D+L T E L +++F A WCG CK + P+ + A + Sbjct: 161 EPSASVELNSSNFDELVTESKE----LWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKL 216 Query: 184 XXXXXXXXXXXASEYNINSMPTFVFVKNGK 273 S + + PT + + K Sbjct: 217 GHVNCDAEQSIKSRFKVQGFPTILVFGSDK 246 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/77 (24%), Positives = 33/77 (42%), Gaps = 3/77 (3%) Frame = +1 Query: 85 VVIDFMATWCGPCKMIGPKLD---EIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 255 + +DF A WCG CK + P+LD I A++ A + I++ PT + Sbjct: 52 IFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPIVIAKLNADKYSRLARKIEIDAFPTLM 111 Query: 256 FVKNGKKLDEFSGANVD 306 +G ++ + D Sbjct: 112 LYNHGVPMEYYGPRKAD 128 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 37.9 bits (84), Expect = 0.007 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 1/73 (1%) Frame = +1 Query: 85 VVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 261 VVI +MA WC C + PKL+++AAE S + MPT Sbjct: 101 VVIVWMAAWCRKCIYLKPKLEKLAAEFYPRLRFYHVDVNAVPYRLVSRAGVTKMPTIQLW 160 Query: 262 KNGKKLDEFSGAN 300 ++G+K E G + Sbjct: 161 RDGQKQAEVIGGH 173 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 37.5 bits (83), Expect = 0.009 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +1 Query: 76 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTF 252 ++ V+++F A WCG C+ + P+ A E+ A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 253 VFVKNGK 273 +F +G+ Sbjct: 180 LFFVDGE 186 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/69 (21%), Positives = 26/69 (37%) Frame = +1 Query: 79 KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVF 258 K V+++ A WCG C+ + P +++A + + PT +F Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTILF 519 Query: 259 VKNGKKLDE 285 G K E Sbjct: 520 FPAGNKTSE 528 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 37.5 bits (83), Expect = 0.009 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +1 Query: 76 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTF 252 ++ V+++F A WCG C+ + P+ A E+ A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 253 VFVKNGK 273 +F +G+ Sbjct: 180 LFFVDGE 186 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/69 (21%), Positives = 26/69 (37%) Frame = +1 Query: 79 KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVF 258 K V+++ A WCG C+ + P +++A + + PT +F Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTILF 519 Query: 259 VKNGKKLDE 285 G K E Sbjct: 520 FPAGNKTSE 528 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 37.5 bits (83), Expect = 0.009 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = +1 Query: 85 VVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 261 ++I++MA+WC C + PKL+++AAE NI+ MPT Sbjct: 121 IIIEWMASWCRKCIYLKPKLEKLAAEYNNRAKFYYVDVNKVPQTLVKRGNISKMPTIQLW 180 Query: 262 KNGKKLDEFSGAN 300 K + +E G + Sbjct: 181 KEDEMKEEVIGGH 193 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 37.5 bits (83), Expect = 0.009 Identities = 19/72 (26%), Positives = 32/72 (44%) Frame = +1 Query: 85 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 264 VV+ F A+WC K + +A + + Y++ ++P FVF K Sbjct: 24 VVLHFWASWCDASKQMDQVFSHLATDFPRAHFFRVEAEEHPEI-SEAYSVAAVPYFVFFK 82 Query: 265 NGKKLDEFSGAN 300 +GK +D GA+ Sbjct: 83 DGKTVDTLEGAD 94 >At1g76080.1 68414.m08835 thioredoxin family protein low similarity to thioredoxin (TRX) [Fasciola hepatica] GI:6687568; contains Pfam profile PF00085: Thioredoxin Length = 302 Score = 37.1 bits (82), Expect = 0.012 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 3/78 (3%) Frame = +1 Query: 73 GDKLVVIDFMATWCGPCKMIGP---KLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSM 243 G KL+V+D CGPC + P KL +E + N+ + Sbjct: 206 GGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETVVFARMNGDENDSCMEFLKDMNVIEV 265 Query: 244 PTFVFVKNGKKLDEFSGA 297 PTF+F+++G+ + G+ Sbjct: 266 PTFLFIRDGEIRGRYVGS 283 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 36.7 bits (81), Expect = 0.016 Identities = 16/73 (21%), Positives = 28/73 (38%) Frame = +1 Query: 76 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 255 + +++F A WCG C+ + P+ A E+ A +Y I PT Sbjct: 116 NSFAMVEFYAPWCGACQALTPEYAAAATELKGLAALAKIDATEEGDLAQKYEIQGFPTVF 175 Query: 256 FVKNGKKLDEFSG 294 +G+ + G Sbjct: 176 LFVDGEMRKTYEG 188 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 36.7 bits (81), Expect = 0.016 Identities = 24/85 (28%), Positives = 39/85 (45%) Frame = +1 Query: 43 DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXAS 222 DD+K+ + A VI++ A+WCG C I P +++ + Sbjct: 37 DDIKSSKSPA-----VINYGASWCGVCSQILPAFRKLSNSFSKLKFVYADIDECPE---T 88 Query: 223 EYNINSMPTFVFVKNGKKLDEFSGA 297 +I PTF F ++G+K+DE GA Sbjct: 89 TRHIRYTPTFQFYRDGEKVDEMFGA 113 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 35.9 bits (79), Expect = 0.028 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 2/96 (2%) Frame = +1 Query: 19 MSIHIKD--SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 192 MS +KD S + L +G LV + F A+WC K + +A + Sbjct: 1 MSGTVKDIVSKEELDNLRHSGAPLV-LHFWASWCDASKQMDQVFSHLATDFPRAHFFRVE 59 Query: 193 XXXXXXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 300 + Y++ +P FVF K+GK +D GA+ Sbjct: 60 AEEHPEI-SEAYSVALVPYFVFFKDGKTVDTLEGAD 94 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 35.5 bits (78), Expect = 0.037 Identities = 19/76 (25%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = +1 Query: 76 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPT 249 +K V+++F A WCG CK + P +++A A +Y ++ PT Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPT 218 Query: 250 F-VFVKNGKKLDEFSG 294 F K+ K ++ G Sbjct: 219 LKFFPKDNKAGHDYDG 234 Score = 34.7 bits (76), Expect = 0.065 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 76 DKLVVIDFMATWCGPCKMIGPKLDEIAA 159 DK +++F A WCG CK + P+ +++ A Sbjct: 40 DKGALVEFYAPWCGHCKKLAPEYEKLGA 67 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 35.5 bits (78), Expect = 0.037 Identities = 19/76 (25%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = +1 Query: 76 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPT 249 +K V+++F A WCG CK + P +++A A +Y ++ PT Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPT 218 Query: 250 F-VFVKNGKKLDEFSG 294 F K+ K ++ G Sbjct: 219 LKFFPKDNKAGHDYDG 234 Score = 34.7 bits (76), Expect = 0.065 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 76 DKLVVIDFMATWCGPCKMIGPKLDEIAA 159 DK +++F A WCG CK + P+ +++ A Sbjct: 40 DKGALVEFYAPWCGHCKKLAPEYEKLGA 67 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 34.3 bits (75), Expect = 0.086 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 28 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEI 153 ++ D K +++ K +++ F A WC PC+ PKL E+ Sbjct: 347 YVLGKDGAKVLVSDLVGKTILMYFSAHWCPPCRAFTPKLVEV 388 Score = 32.7 bits (71), Expect = 0.26 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 79 KLVVIDFMATWCGPCKMIGPKLDEIAAEM 165 K + + F A WCGPC+ P+L E+ E+ Sbjct: 44 KKIGLYFSAAWCGPCQRFTPQLVEVYNEL 72 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 33.5 bits (73), Expect = 0.15 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 9/95 (9%) Frame = +1 Query: 34 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIA-------AEMXXXXXXX 186 K D+L + L ++ + LVV+DF T CG CK I ++ A + Sbjct: 104 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNV 163 Query: 187 XXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFS 291 A I ++P F F KNG L+ F+ Sbjct: 164 VDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFA 198 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 33.5 bits (73), Expect = 0.15 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 9/95 (9%) Frame = +1 Query: 34 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIA-------AEMXXXXXXX 186 K D+L + L ++ + LVV+DF T CG CK I ++ A + Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNV 150 Query: 187 XXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFS 291 A I ++P F F KNG L+ F+ Sbjct: 151 VDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFA 185 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.3 bits (70), Expect = 0.35 Identities = 16/70 (22%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +1 Query: 91 IDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPTFVFVK 264 + F WC CK +G +++ M A ++ I+S PTF+ Sbjct: 48 VKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFY 107 Query: 265 NGKKLDEFSG 294 NG+++ ++ G Sbjct: 108 NGEEVSKYKG 117 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.3 bits (70), Expect = 0.35 Identities = 16/70 (22%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +1 Query: 91 IDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPTFVFVK 264 + F WC CK +G +++ M A ++ I+S PTF+ Sbjct: 48 VKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFY 107 Query: 265 NGKKLDEFSG 294 NG+++ ++ G Sbjct: 108 NGEEVSKYKG 117 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.3 bits (70), Expect = 0.35 Identities = 16/70 (22%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +1 Query: 91 IDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPTFVFVK 264 + F WC CK +G +++ M A ++ I+S PTF+ Sbjct: 48 VKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFY 107 Query: 265 NGKKLDEFSG 294 NG+++ ++ G Sbjct: 108 NGEEVSKYKG 117 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 31.9 bits (69), Expect = 0.46 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = +1 Query: 37 DSDDLKTRLA-EAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXX 213 D D L +A + G+ + + F A+WC + + PK D +++ Sbjct: 60 DGDSLDRLMASQHGNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQIQHLAVEHSQALPS 119 Query: 214 XASEYNINSMPTFVFV 261 S Y I+S+P+ + V Sbjct: 120 VFSRYGIHSLPSILMV 135 >At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH-dependent thioredoxin reductase, putative The last 2 exons encode thioredoxin. There is an EST match to exons 5-7, and the distance between exon 7 and exon 8 is only 90bp. It is unlikely this is two separate genes, but more likely a hybrid protein. Length = 529 Score = 31.9 bits (69), Expect = 0.46 Identities = 17/82 (20%), Positives = 32/82 (39%) Frame = +1 Query: 58 RLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNIN 237 +L +++++ + + CGPC+ + P L+++ E A I Sbjct: 436 KLYHESPRVILVLYTSPTCGPCRTLKPILNKVVDEYNHDVHFVEIDIEEDQEIAEAAGIM 495 Query: 238 SMPTFVFVKNGKKLDEFSGANV 303 P F KN + L SG + Sbjct: 496 GTPCVQFFKNKEMLRTISGVKM 517 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +1 Query: 34 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMI 132 K D+L + L ++ + LVV+DF T CG CK I Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYI 125 >At4g30290.1 68417.m04305 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative similar to xyloglucan endotransglycosylase TCH4 GI:886116 from [Arabidopsis thaliana] Length = 277 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 516 QQNQYFLHSRGCKHKKLISSNSLQTLKTFFI 424 Q NQ FL+ + KL+ NS T+ TF++ Sbjct: 60 QSNQEFLYGKAEVQMKLVPGNSAGTVTTFYL 90 >At4g30280.1 68417.m04304 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative similar to xyloglucan endotransglycosylase TCH4 GI:886116 from [Arabidopsis thaliana] Length = 282 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 516 QQNQYFLHSRGCKHKKLISSNSLQTLKTFFI 424 Q NQ FL+ + KL+ NS T+ TF++ Sbjct: 65 QSNQEFLYGKAEVQMKLVPGNSAGTVTTFYL 95 >At1g65310.1 68414.m07406 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative similar to xyloglucan endotransglycosylase TCH4 GI:886116 from [Arabidopsis thaliana] Length = 282 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 516 QQNQYFLHSRGCKHKKLISSNSLQTLKTFFI 424 Q NQ FL+ + KL+ NS T+ TF++ Sbjct: 65 QSNQEFLYGKAEVQMKLVPGNSAGTVTTFYL 95 >At1g43100.1 68414.m04965 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 444 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +2 Query: 389 KKKKHVYVFNK*IKNVFNVCNEFEDINFLCLQPLECK 499 K K HV + + +KN++ N +N C + CK Sbjct: 327 KGKSHVQIQDIKLKNIYGTSNNIVAVNLQCSKSFPCK 363 >At1g43090.1 68414.m04964 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 444 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +2 Query: 389 KKKKHVYVFNK*IKNVFNVCNEFEDINFLCLQPLECK 499 K K HV + + +KN++ N +N C + CK Sbjct: 327 KGKSHVQIQDIKLKNIYGTSNNIVAVNLQCSKSFPCK 363 >At4g31240.2 68417.m04435 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 79 KLVVIDFMATWCGPCKMIGPKL 144 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At4g31240.1 68417.m04434 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 79 KLVVIDFMATWCGPCKMIGPKL 144 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At1g78740.1 68414.m09177 hypothetical protein Length = 306 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 344 SIYLCLRIVVLSLSTLA-PENSSSFLPFLTKTNVG 243 +IY+C +V L LST+ P S LPFL +G Sbjct: 94 TIYICESLVSLKLSTVTLPSVKSVSLPFLRVLKLG 128 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 27.5 bits (58), Expect = 9.8 Identities = 19/81 (23%), Positives = 30/81 (37%), Gaps = 3/81 (3%) Frame = +1 Query: 73 GDKLVVIDFMATWCGPCKMIGPKLDEIAA---EMXXXXXXXXXXXXXXXXXASEYNINSM 243 G++ V++ A WC + P+ E A E+ ASE I Sbjct: 93 GNEFVMVLGYAPWCARSAELMPRFAEAATALKEIGSSVLMAKIDGDRYSKIASELEIKGF 152 Query: 244 PTFVFVKNGKKLDEFSGANVD 306 PT + NG L G++ + Sbjct: 153 PTLLLFVNGTSLTYNGGSSAE 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,402,566 Number of Sequences: 28952 Number of extensions: 270835 Number of successful extensions: 779 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 751 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -