BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0434 (673 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g33040.1 68415.m04052 ATP synthase gamma chain, mitochondrial... 73 2e-13 At4g04640.1 68417.m00679 ATP synthase gamma chain 1, chloroplast... 61 6e-10 At1g15700.1 68414.m01884 ATP synthase gamma chain 2, chloroplast... 56 3e-08 At5g18860.1 68418.m02241 inosine-uridine preferring nucleoside h... 29 2.1 At4g33430.1 68417.m04750 brassinosteroid insensitive 1-associate... 29 2.8 At5g19130.2 68418.m02277 GPI transamidase component family prote... 29 3.7 At5g19130.1 68418.m02276 GPI transamidase component family prote... 29 3.7 At5g24550.1 68418.m02899 glycosyl hydrolase family 1 protein con... 28 4.9 At2g36670.2 68415.m04498 aspartyl protease family protein contai... 28 4.9 At2g36670.1 68415.m04497 aspartyl protease family protein contai... 28 4.9 At2g13790.1 68415.m01522 leucine-rich repeat family protein / pr... 28 4.9 At4g02350.1 68417.m00319 exocyst complex subunit Sec15-like fami... 28 6.5 At3g60140.1 68416.m06715 glycosyl hydrolase family 1 protein con... 28 6.5 At4g21050.1 68417.m03044 Dof-type zinc finger domain-containing ... 27 8.6 At3g21200.1 68416.m02679 expressed protein 27 8.6 >At2g33040.1 68415.m04052 ATP synthase gamma chain, mitochondrial (ATPC) identical to SP|Q96250 ATP synthase gamma chain, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; contains Pfam profile: PF00231 ATP synthase Length = 325 Score = 72.5 bits (170), Expect = 2e-13 Identities = 47/148 (31%), Positives = 82/148 (55%), Gaps = 2/148 (1%) Frame = +3 Query: 141 RNMATLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQFYERAEV 320 R+++T + + R+KSVKNIQKIT++MKMV+A+K + + +R + F Sbjct: 41 RSIST-QVVRNRMKSVKNIQKITKAMKMVAASKLRAVQGRAENSRGLWQ---PFTALLGD 96 Query: 321 TPPEDDPKQLFVAMTSDRGLCGAVHTGVSKVIR--NRLSEPGAENIKVICVGDKSRGILQ 494 P D K + V ++SD+GLCG +++ V KV R +L+ + ++ + VG+K++ I+ Sbjct: 97 NPSIDVKKSVVVTLSSDKGLCGGINSTVVKVSRALYKLNAGPEKEVQFVIVGEKAKAIMF 156 Query: 495 RLYGKHIISVANEIGRLPPTFLDASQLA 578 R I+ E+ + P + S LA Sbjct: 157 RDSKNDIVLSVTELNKNPLNYAQVSVLA 184 >At4g04640.1 68417.m00679 ATP synthase gamma chain 1, chloroplast (ATPC1) identical to SP|Q01908 ATP synthase gamma chain 1, chloroplast precursor (EC 3.6.3.14) {Arabidopsis thaliana} Length = 373 Score = 61.3 bits (142), Expect = 6e-10 Identities = 45/132 (34%), Positives = 64/132 (48%), Gaps = 14/132 (10%) Frame = +3 Query: 150 ATLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQFYERAEVTPP 329 A+L+ + R+ SVKN QKIT++MK+V+AAK RA+ + RP+ E V+ Sbjct: 51 ASLRELRDRIDSVKNTQKITEAMKLVAAAKVRRAQEAVVNGRPFSETLVEVLYNINEQLQ 110 Query: 330 EDD-----------PKQLFVAMTSDRGLCGAVHTGVSKVIRNRLSEPGAENIK--VICVG 470 DD K V +T DRGLCG + + K R+ E ++ VI VG Sbjct: 111 TDDVDVPLTKVRPVKKVALVVVTGDRGLCGGFNNFIIKKAEARIKELKGLGLEYTVISVG 170 Query: 471 DKSRG-ILQRLY 503 K L+R Y Sbjct: 171 KKGNSYFLRRPY 182 >At1g15700.1 68414.m01884 ATP synthase gamma chain 2, chloroplast (ATPC2) identical to SP|Q01909 ATP synthase gamma chain 2, chloroplast precursor (EC 3.6.3.14) {Arabidopsis thaliana}; contains Pfam profile: PF00231 ATP synthase; similar to ATP synthase gamma-subunit GI:21241 from [Spinacia oleracea] Length = 386 Score = 55.6 bits (128), Expect = 3e-08 Identities = 48/156 (30%), Positives = 73/156 (46%), Gaps = 13/156 (8%) Frame = +3 Query: 150 ATLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQ-FYERAEVTP 326 A ++ + R+ SVKN QKIT++M++V+AA+ RA+ + RP+ E V+ Y + Sbjct: 61 AGIRELRERIDSVKNTQKITEAMRLVAAARVRRAQDAVIKGRPFTETLVEILYSINQSAQ 120 Query: 327 PEDDPKQL----------FVAMTSDRGLCGAVHTGVSKVIRNRLSEPGAENIK--VICVG 470 ED L V +T D+GLCG + V+K R+ E I VI VG Sbjct: 121 LEDIDFPLSIVRPVKRVALVVVTGDKGLCGGFNNAVTKKATLRVQELKQRGIDCVVISVG 180 Query: 471 DKSRGILQRLYGKHIISVANEIGRLPPTFLDASQLA 578 K R + + E G + PT +A +A Sbjct: 181 KKGNAYFSR-RDEFDVDKCIEGGGVFPTTKEAQVIA 215 >At5g18860.1 68418.m02241 inosine-uridine preferring nucleoside hydrolase family protein contains Pfam profile PF01156: Inosine-uridine preferring nucleoside hydrolase Length = 890 Score = 29.5 bits (63), Expect = 2.1 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 3/77 (3%) Frame = +3 Query: 441 AENIKVICVGDKSRG---ILQRLYGKHIISVANEIGRLPPTFLDASQLALLSSPRDTSLV 611 AE+IKVI GD+SR ++ +L GK I + R+ + S + L + ++++ Sbjct: 820 AEHIKVIAEGDESRDGKILIDKLRGKQI----KILERVDLISISESFASRLDDKKQSAVI 875 Query: 612 PERSFTTSSSLWSRTPS 662 SF +WS PS Sbjct: 876 --GSFEEQKKIWSTPPS 890 >At4g33430.1 68417.m04750 brassinosteroid insensitive 1-associated receptor kinase 1 (BAK1) / somatic embryogenesis receptor-like kinase 3 (SERK3) identical to SP|Q94F62 BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor (EC 2.7.1.37) (BRI1-associated receptor kinase 1) (Somatic embryogenesis receptor-like kinase 3) {Arabidopsis thaliana}; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain; identical to cDNA somatic embryogenesis receptor-like kinase 3 (SERK3) GI:14573458 Length = 615 Score = 29.1 bits (62), Expect = 2.8 Identities = 26/93 (27%), Positives = 38/93 (40%), Gaps = 4/93 (4%) Frame = +3 Query: 306 ERAEVTPPEDDPKQLFVAMTSDRGLCGAVHTGVSKVIRNRLSEPGA---ENIKVICVGDK 476 ER E PP D PK+ +A+ S RGL K+I + E + + VGD Sbjct: 377 ERPESQPPLDWPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAV-VGDF 435 Query: 477 SRGILQRLYGKHI-ISVANEIGRLPPTFLDASQ 572 L H+ +V IG + P +L + Sbjct: 436 GLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGK 468 >At5g19130.2 68418.m02277 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 696 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -1 Query: 529 LATLMMCFPYNLCRIPRDLSPTQITLMFSAPGSLRRLRITLDTPVCT 389 L ++ PY +C++P SPT ++M+ S L + P C+ Sbjct: 508 LGFIVTLLPYFICQVPGQHSPTNRSIMWGTTSSSLLLITFVTMPGCS 554 >At5g19130.1 68418.m02276 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 699 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -1 Query: 529 LATLMMCFPYNLCRIPRDLSPTQITLMFSAPGSLRRLRITLDTPVCT 389 L ++ PY +C++P SPT ++M+ S L + P C+ Sbjct: 511 LGFIVTLLPYFICQVPGQHSPTNRSIMWGTTSSSLLLITFVTMPGCS 557 >At5g24550.1 68418.m02899 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to anther-specific protein ATA27 (GI:2746341) [Arabidopsis thaliana] Length = 534 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -3 Query: 545 ETSDLISNTNDVLSVQSLQDTARFISHTDHLDVLSTRFAETVADHFGY 402 E S ++ N+ D + + TARF++H H+D+ RF T H Y Sbjct: 327 EQSMMLQNSFDFIGINYY--TARFVAHDLHVDLSRPRF--TTDQHLQY 370 >At2g36670.2 68415.m04498 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 507 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 448 FSAPGSLRRLRITLDTPVCTAPHKPLSEVIATNNCLGSS 332 F APGSL +T P+C++ + + + NN G S Sbjct: 147 FDAPGSLTAGSVTCSDPICSSVFQTTAAQCSENNQCGYS 185 >At2g36670.1 68415.m04497 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 512 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 448 FSAPGSLRRLRITLDTPVCTAPHKPLSEVIATNNCLGSS 332 F APGSL +T P+C++ + + + NN G S Sbjct: 152 FDAPGSLTAGSVTCSDPICSSVFQTTAAQCSENNQCGYS 190 >At2g13790.1 68415.m01522 leucine-rich repeat family protein / protein kinase family protein Length = 620 Score = 28.3 bits (60), Expect = 4.9 Identities = 25/93 (26%), Positives = 37/93 (39%), Gaps = 4/93 (4%) Frame = +3 Query: 306 ERAEVTPPEDDPKQLFVAMTSDRGLCGAVHTGVSKVIRNRLSEPGA---ENIKVICVGDK 476 ER E P D PK+ +A+ S RGL K+I + E + + VGD Sbjct: 382 ERPEGNPALDWPKRKHIALGSARGLAYLHDHCDQKIIHRDVKAANILLDEEFEAV-VGDF 440 Query: 477 SRGILQRLYGKHI-ISVANEIGRLPPTFLDASQ 572 L H+ +V IG + P +L + Sbjct: 441 GLAKLMNYNDSHVTTAVRGTIGHIAPEYLSTGK 473 >At4g02350.1 68417.m00319 exocyst complex subunit Sec15-like family protein contains Pfam profile PF04091: Exocyst complex subunit Sec15-like Length = 771 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -3 Query: 476 FISHTDHLDVLSTRFAETVADHFGYTSVYSSAQTSVRGHSNKQLLG 339 F H HL + R AE HF T ++A+ ++ G K++ G Sbjct: 536 FFRHAAHLSGVPLRMAERGRRHFPLTKSQNTAEDTLSGMLKKKIDG 581 >At3g60140.1 68416.m06715 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to Cyanogenic Beta-Glucosidase (GI:1311386)(pdb:1CBG) [Trifolium Repens]; identical beta-glucosidase GI:10834547 Length = 577 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -3 Query: 545 ETSDLISNTNDVLSVQSLQDTARFISHTDHLDVLSTRF 432 E S ++ N++D + + TARF +H H+D RF Sbjct: 321 EQSKMLQNSSDFVGINYY--TARFAAHLPHIDPEKPRF 356 >At4g21050.1 68417.m03044 Dof-type zinc finger domain-containing protein PBF protein, Triticum aestivum, EMBL:AJ012284 Length = 210 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -3 Query: 539 SDLISNTNDVLSVQSLQDTARFISHTDHLDVLSTRFAETVADHFGYTS 396 S+++S N ++ QS + T D S+ V +HFGY S Sbjct: 87 SEMVSVENQPINHQSFRQTQENNEFVRSFDASSSATVTAVPNHFGYLS 134 >At3g21200.1 68416.m02679 expressed protein Length = 317 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 445 SAPGSLR-RLRITLDTPVCTAPHKPLSEVIATNNCLGSSSGGVTSALS 305 S P SLR + TLDTP + HKP + + + + SS G S L+ Sbjct: 35 SRPISLRCSVSTTLDTPATASTHKPFPAEV-SRSIMELSSVGTLSTLT 81 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,599,177 Number of Sequences: 28952 Number of extensions: 373622 Number of successful extensions: 995 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 992 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -