BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0430 (798 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC306.04c |set1||histone lysine methyltransferase Set1|Schizos... 28 1.8 SPAC25B8.17 |||peptidase family A22|Schizosaccharomyces pombe|ch... 26 5.4 >SPCC306.04c |set1||histone lysine methyltransferase Set1|Schizosaccharomyces pombe|chr 3|||Manual Length = 920 Score = 27.9 bits (59), Expect = 1.8 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = +3 Query: 51 KWHKF-SKYKRTHRKYERFGLEDVFTFCDTQIFVGYISPGKGLSFSGTSKKEMYYSIQK 224 K+H+F +K K + +KYE+ + D + +T+ +SP + SG++ K+ S +K Sbjct: 539 KFHRFRTKSKISKKKYEKMEV-DYTSSSETESDASILSPSAAIPKSGSAIKDELISPKK 596 >SPAC25B8.17 |||peptidase family A22|Schizosaccharomyces pombe|chr 1|||Manual Length = 295 Score = 26.2 bits (55), Expect = 5.4 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = -2 Query: 341 RKHSPI--KTEILRGKGKGFLRF--FYFKTRNVTYLYLSP 234 +KHS T I G G G F +YFK LYLSP Sbjct: 217 KKHSTYFRNTFIAYGLGLGVTNFALYYFKAAQPALLYLSP 256 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,858,694 Number of Sequences: 5004 Number of extensions: 53079 Number of successful extensions: 104 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 389395636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -