BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0430 (798 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40797-8|AAL08029.1| 332|Caenorhabditis elegans Serpentine rece... 31 1.3 U29244-18|AAC71099.2| 515|Caenorhabditis elegans Hypothetical p... 28 6.7 AF068713-10|AAC17801.1| 376|Caenorhabditis elegans Serpentine r... 28 8.9 >U40797-8|AAL08029.1| 332|Caenorhabditis elegans Serpentine receptor, class u protein7 protein. Length = 332 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = -3 Query: 757 NVLLFFFNKNSYKVPSL*LTEAACRLTNYEQFFIF*LKQRL*LFILAVLIP 605 N+L FFF+ S + P+ + + C +N+E IF L L LA+ P Sbjct: 75 NILSFFFDYMSNRFPATGMMTSWCASSNHETLLIFILTSHFYLDYLAMGFP 125 >U29244-18|AAC71099.2| 515|Caenorhabditis elegans Hypothetical protein ZK1248.1 protein. Length = 515 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 42 SELKWHKFSKYKRTHRKYERFGLEDVFTFCD 134 S+LK +KY++ H K+++F ED F + Sbjct: 64 SKLKAGMVAKYRKKHPKFDKFKGEDAFAIAE 94 >AF068713-10|AAC17801.1| 376|Caenorhabditis elegans Serpentine receptor, class w protein130 protein. Length = 376 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 570 STNTFLNIRSFFGIKTARINNYSRC 644 S + F++I FFG K A NYS C Sbjct: 171 SISLFMDILDFFGYKIASQKNYSPC 195 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,161,724 Number of Sequences: 27780 Number of extensions: 278157 Number of successful extensions: 598 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -