BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0428 (679 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13400.1 68418.m01543 proton-dependent oligopeptide transport... 28 6.5 At1g01650.1 68414.m00083 protease-associated (PA) domain-contain... 27 8.6 >At5g13400.1 68418.m01543 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 624 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 568 SPVKLLTITQDLSLKYATRTVTNPTCSPGVSL 473 SP KL T+TQ +K R + PTC+ +SL Sbjct: 359 SPWKLCTVTQVEEVKILIRLIPIPTCTIMLSL 390 >At1g01650.1 68414.m00083 protease-associated (PA) domain-containing protein contains protease associated (PA) domain, Pfam:PF02225 Length = 491 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 483 PGLQVGFVTVLVAYLSDKSWVIVNNF 560 P L+VGFV + A++ D WV V+ + Sbjct: 322 PNLKVGFVLLSCAFMYDIFWVFVSKW 347 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,630,387 Number of Sequences: 28952 Number of extensions: 255349 Number of successful extensions: 468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -