BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0427 (819 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 23 2.2 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 3.9 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 22 6.7 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 8.9 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 8.9 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.9 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.9 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 23.4 bits (48), Expect = 2.2 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 300 SVNRVGNDTTNSPGADVEWSRYLNTSLMPCSNSGTS 193 SV VG D +SPGA + + PCS + TS Sbjct: 154 SVGLVGGDPASSPGAAAGRTGNSLSWNNPCSINSTS 189 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.6 bits (46), Expect = 3.9 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -1 Query: 288 VGNDTTNSPGADVEWSRYLNTSLMPCSNSGTS 193 + D TNS V+ + S M CS++G S Sbjct: 325 ITGDKTNSVFEHVKLGSLYHISFMACSSAGCS 356 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 423 ITTSQEHIKTLQLGGFDSWS 364 I+ E+ K+L LGG WS Sbjct: 339 ISNKVEYAKSLNLGGVMIWS 358 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 98 DVCPHARMPILDKLISSVSHHV 163 D + ++P+L KLI S+ H+ Sbjct: 254 DAYGNVKIPVLCKLIQSIPTHL 275 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 408 EHIKTLQLGGFDSWSSYQ 355 E L+L GF+ W YQ Sbjct: 31 ERTPGLELEGFNFWGKYQ 48 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 408 EHIKTLQLGGFDSWSSYQ 355 E L+L GF+ W YQ Sbjct: 191 ERTPGLELEGFNFWGKYQ 208 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 408 EHIKTLQLGGFDSWSSYQ 355 E L+L GF+ W YQ Sbjct: 191 ERTPGLELEGFNFWGKYQ 208 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,418 Number of Sequences: 336 Number of extensions: 3453 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22414104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -