BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0427 (819 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22A12.12c |||exosome subunit Rrp40 |Schizosaccharomyces pomb... 25 9.8 SPAC926.06c |||leucine-rich repeat protein, unknown|Schizosaccha... 25 9.8 >SPAC22A12.12c |||exosome subunit Rrp40 |Schizosaccharomyces pombe|chr 1|||Manual Length = 240 Score = 25.4 bits (53), Expect = 9.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 211 QQQRHERVVVSVAGRAHMVG 152 ++ R E +VVS AGR H G Sbjct: 40 KKDREEEIVVSKAGRLHQTG 59 >SPAC926.06c |||leucine-rich repeat protein, unknown|Schizosaccharomyces pombe|chr 1|||Manual Length = 621 Score = 25.4 bits (53), Expect = 9.8 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -1 Query: 144 DINLSKIGIRACGHTSHAMSTDMSVFSSARMALSSARNESKLLRL 10 D N+S I G +S+ S+FS+A S RN+ ++L + Sbjct: 99 DDNMSLNSIVTMGSILSNVSSVWSIFSTAPSEASETRNKQRILAI 143 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,951,118 Number of Sequences: 5004 Number of extensions: 55632 Number of successful extensions: 128 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 400438000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -